Foxa2 (NM_010446) Mouse Tagged ORF Clone

SKU
MR227354
Foxa2 (Myc-DDK-tagged) - Mouse forkhead box A2 (Foxa2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$686.00
5 Days*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Foxa2
Synonyms Hnf-3b; HNF3-beta; Hnf3b; HNF3beta; Tcf-3b; Tcf3b
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR227354 representing NM_010446
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGGAGCCGTGAAGATGGAAGGGCACGAGCCATCCGACTGGAGCAGCTACTACGCGGAGCCCGAGG
GCTACTCTTCCGTGAGCAACATGAACGCCGGCCTGGGGATGAATGGCATGAACACATACATGAGCATGTC
CGCGGCTGCCATGGGCGGCGGTTCCGGCAACATGAGCGCGGGCTCCATGAACATGTCATCCTATGTGGGC
GCTGGAATGAGCCCGTCGCTAGCTGGCATGTCCCCGGGCGCCGGCGCCATGGCGGGCATGAGCGGCTCAG
CCGGGGCGGCCGGCGTGGCGGGCATGGGACCTCACCTGAGTCCGAGTCTGAGCCCGCTCGGGGGACAGGC
GGCCGGGGCCATGGGTGGCCTTGCCCCCTACGCCAACATGAACTCGATGAGCCCCATGTACGGGCAGGCC
GGCCTGAGCCGCGCTCGGGACCCCAAGACATACCGACGCAGCTACACACACGCCAAACCTCCCTACTCGT
ACATCTCGCTCATCACCATGGCCATCCAGCAGAGCCCCAACAAGATGCTGACGCTGAGCGAGATCTATCA
GTGGATCATGGACCTCTTCCCTTTCTACCGGCAGAACCAGCAGCGCTGGCAGAACTCCATCCGCCACTCT
CTCTCCTTCAACGACTGCTTTCTCAAGGTGCCCCGCTCGCCAGACAAGCCTGGCAAGGGCTCCTTCTGGA
CCCTGCACCCAGACTCGGGCAACATGTTCGAGAACGGCTGCTACCTGCGCCGCCAGAAGCGCTTCAAGTG
TGAGAAGCAACTGGCACTGAAGGAAGCCGCGGGTGCGGCCAGTAGCGGAGGCAAGAAGACCGCTCCTGGG
TCCCAGGCCTCTCAGGCTCAGCTCGGGGAGGCCGCGGGCTCGGCCTCCGAGACTCCGGCGGGCACCGAGT
CCCCCCATTCCAGCGCTTCTCCGTGTCAGGAGCACAAGCGAGGTGGCCTAAGCGAGCTAAAGGGAGCACC
TGCCTCTGCGCTGAGTCCTCCCGAGCCGGCGCCCTCGCCTGGGCAGCAGCAGCAGGCTGCAGCCCACCTG
CTGGGCCCACCTCACCACCCAGGCCTGCCACCAGAGGCCCACCTGAAGCCCGAGCACCATTACGCCTTCA
ACCACCCCTTCTCTATCAACAACCTCATGTCGTCCGAGCAGCAACATCACCACAGCCACCACCACCATCA
GCCCCACAAAATGGACCTCAAGGCCTACGAACAGGTCATGCACTACCCAGGGGGCTATGGTTCCCCCATG
CCAGGCAGCTTGGCCATGGGCCCAGTCACGAACAAAGCGGGCCTGGATGCCTCGCCCCTGGCTGCAGACA
CTTCCTACTACCAAGGAGTGTACTCCAGGCCTATTATGAACTCATCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR227354 representing NM_010446
Red=Cloning site Green=Tags(s)

MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGGGSGNMSAGSMNMSSYVG
AGMSPSLAGMSPGAGAMAGMSGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQA
GLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHS
LSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAASSGGKKTAPG
SQASQAQLGEAAGSASETPAGTESPHSSASPCQEHKRGGLSELKGAPASALSPPEPAPSPGQQQQAAAHL
LGPPHHPGLPPEAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGGYGSPM
PGSLAMGPVTNKAGLDASPLAADTSYYQGVYSRPIMNSS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_010446
ORF Size 1377 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_010446.3
RefSeq Size 2127 bp
RefSeq ORF 1380 bp
Locus ID 15376
UniProt ID P35583
Cytogenetics 2 73.38 cM
MW 48.9 kDa
Summary Transcription factor that is involved in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. Is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites. Binds DNA with the consensus sequence 5'-[AC]A[AT]T[AG]TT[GT][AG][CT]T[CT]-3' (By similarity). In embryonic development is required for notochord formation. Involved in the development of multiple endoderm-derived organ systems such as the liver, pancreas and lungs; Foxa1 and Foxa2 seem to have at least in part redundant roles. FOXA1 and FOXA2 are essential for hepatic specification. FOXA1 and FOXA2 are required for morphogenesis and cell differentiation during formation of the lung. FOXA1 and FOXA2 are involved in bile duct formation; they positively regulate the binding glucocorticoid receptor/NR3C1 to the IL6 promoter. FOXA1 and FOXA2 regulate multiple phases of midbrain dopaminergic neuron development; they regulate expression of NEUROG2 at the beginning of mDA neurogenesis and of NR4A2 and EN1 in immature mDA neurons. Modulates the transcriptional activity of nuclear hormone receptors; inhibits AR-mediated transcription from the LCN5 promoter. Binds to fibrinogen beta promoter and is involved in IL6-induced fibrinogen beta transcriptional activation. Originally described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes. Involved in glucose homeostasis; regulates the expression of genes important for glucose sensing in pancreatic beta-cells and glucose homeostasis. In pancreatic beta cells activates transcription of potassium channel subunits KCNJ11 and ABCC8. Involved in regulation of fat metabolism; activates transcriptional programs of lipid metabolism and ketogenesis at low insulin state. Involved in transcriptional regulation of MUC2 in the intestine.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Foxa2 (NM_010446) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC216114 Foxa2 (untagged) - Mouse forkhead box A2 (Foxa2), (10ug) 10 ug
$686.00
MG227354 Foxa2 (tGFP-tagged) - Mouse forkhead box A2 (Foxa2), (10ug) 10 ug
$886.00
MR227354L3 Lenti ORF clone of Foxa2 (Myc-DDK-tagged) - Mouse forkhead box A2 (Foxa2) 10 ug
$986.00
MR227354L4 Lenti ORF clone of Foxa2 (mGFP-tagged) - Mouse forkhead box A2 (Foxa2) 10 ug
$986.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.