Timp1 (NM_011593) Mouse Tagged ORF Clone

SKU
MR227162
Timp1 (Myc-DDK-tagged) - Mouse tissue inhibitor of metalloproteinase 1 (Timp1), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Timp1
Synonyms Clgi; EPA; Timp; TIMP-1; TPA-S1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR227162 representing NM_011593
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGGCCCCCTTTGCATCTCTGGCATCTGGCATCCTCTTGTTGCTATCACTGATAGCTTCCAGTAAGG
CCTGTAGCTGTGCCCCACCCCACCCACAGACAGCCTTCTGCAACTCGGACCTGGTCATAAGGGCTAAATT
CATGGGTTCCCCAGAAATCAACGAGACCACCTTATACCAGCGTTATAAGATCAAGATGACTAAGATGCTA
AAAGGATTCAAGGCTGTGGGAAATGCCGCAGATATCCGGTACGCCTACACCCCAGTCATGGAAAGCCTCT
GTGGATATGCCCACAAGTCCCAGAACCGCAGTGAAGAGTTTCTCATCACGGGCCGCCTAAGGAACGGAAA
TTTGCACATCAGTGCCTGCAGCTTCTTGGTTCCCTGGCGTACTCTGAGCCCTGCTCAGCAAAGAGCTTTC
TCAAAGACCTATAGTGCTGGCTGTGGGGTGTGCACAGTGTTTCCCTGTTTATCTATCCCTTGCAAACTGG
AGAGTGACACTCACTGTTTGTGGACGGATCAGGTCCTCGTGGGCTCTGAGGACTACCAGAGCCGTCACTT
TGCTTGCCTGCCACGGAATCCAGGCTTGTGCACCTGGAGATCCCTTGGGGCCCGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR227162 representing NM_011593
Red=Cloning site Green=Tags(s)

MMAPFASLASGILLLLSLIASSKACSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKML
KGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAF
SKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_011593
ORF Size 615 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_011593.2, NP_035723.2
RefSeq Size 902 bp
RefSeq ORF 618 bp
Locus ID 21857
UniProt ID P12032
Cytogenetics X 16.38 cM
MW 23.1 kDa
Summary Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14 (By similarity). Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Timp1 (NM_011593) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC202082 Timp1 (untagged) - Mouse tissue inhibitor of metalloproteinase 1 (Timp1), transcript variant 2, (10ug) 10 ug
$300.00
MG227162 Timp1 (tGFP-tagged) - Mouse tissue inhibitor of metalloproteinase 1 (Timp1) transcript variant 2, (10ug) 10 ug
$500.00
MR227162L3 Lenti ORF clone of Timp1 (Myc-DDK-tagged) - Mouse tissue inhibitor of metalloproteinase 1 (Timp1), transcript variant 2 10 ug
$600.00
MR227162L4 Lenti ORF clone of Timp1 (mGFP-tagged) - Mouse tissue inhibitor of metalloproteinase 1 (Timp1), transcript variant 2 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.