Myd88 (NM_010851) Mouse Tagged ORF Clone

SKU
MR227105
Myd88 (Myc-DDK-tagged) - Mouse myeloid differentiation primary response gene 88 (Myd88)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Myd88
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR227105 representing NM_010851
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGCGGGAGACCCCCGCGTGGGATCCGGGTCCCTGGACTCCTTCATGTTCTCCATACCCTTGGTCG
CGCTTAACGTGGGAGTGAGGCGCCGCCTATCGCTGTTCTTGAACCCTCGGACGCCCGTGGCGGCCGACTG
GACCTTGCTGGCGGAGGAGATGGGCTTCGAGTACTTGGAGATCCGAGAGCTGGAAACGCGCCCTGACCCC
ACTCGCAGTTTGTTGGATGCCTGGCAGGGGCGCTCTGGCGCGTCTGTCGGCAGGCTGCTAGAGCTGCTGG
CCTTGTTAGACCGTGAGGATATACTGAAGGAGCTGAAGTCGCGCATCGAGGAGGACTGCCAGAAATACTT
AGGTAAGCAGCAGAACCAGGAGTCCGAGAAGCCTTTACAGGTGGCCAGAGTGGAAAGCAGTGTCCCACAA
ACAAAGGAACTGGGAGGCATCACCACCCTTGATGACCCCCTAGGACAAACGCCGGAACTTTTCGATGCCT
TTATCTGCTACTGCCCCAACGATATCGAGTTTGTGCAGGAGATGATCCGGCAACTAGAACAGACAGACTA
TCGGCTTAAGTTGTGTGTGTCCGACCGTGACGTCCTGCCGGGCACCTGTGTCTGGTCCATTGCCAGCGAG
CTAATTGAGAAAAGGTGTCGCCGCATGGTGGTGGTTGTTTCTGACGATTATCTACAGAGCAAGGAATGTG
ACTTCCAGACCAAGTTTGCACTCAGCCTGTCTCCAGGTGTCCAACAGAAGCGACTGATTCCTATTAAATA
CAAGGCGATGAAGAAGGACTTTCCCAGTATCCTGCGGTTCATCACTATATGCGACTATACCAACCCTTGC
ACCAAGTCCTGGTTCTGGACCCGCCTTGCCAAGGCTTTGTCCCTGCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR227105 representing NM_010851
Red=Cloning site Green=Tags(s)

MSAGDPRVGSGSLDSFMFSIPLVALNVGVRRRLSLFLNPRTPVAADWTLLAEEMGFEYLEIRELETRPDP
TRSLLDAWQGRSGASVGRLLELLALLDREDILKELKSRIEEDCQKYLGKQQNQESEKPLQVARVESSVPQ
TKELGGITTLDDPLGQTPELFDAFICYCPNDIEFVQEMIRQLEQTDYRLKLCVSDRDVLPGTCVWSIASE
LIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGVQQKRLIPIKYKAMKKDFPSILRFITICDYTNPC
TKSWFWTRLAKALSLP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_010851
ORF Size 888 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_010851.3
RefSeq Size 1947 bp
RefSeq ORF 891 bp
Locus ID 17874
UniProt ID P22366
Cytogenetics 9 71.33 cM
MW 34.2 kDa
Summary Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response (PubMed:9697844). Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (PubMed:9575168, PubMed:9697844). Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway (PubMed:9697844). Isoform 2 is defective in its ability to induce IRAK phosphorylation and NF-kappa-B activation and can function as a negative regulator of activation by IL-1 or lipopolysaccharide (LPS) (PubMed:11909531). Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes (PubMed:17018642). MyD88-mediated signaling in intestinal epithelial cells is crucial for maintenance of gut homeostasis and controls the expression of the antimicrobial lectin REG3G in the small intestine (PubMed:17635956, PubMed:21998396). Mediates leukocyte recruitment at the inflammatory site (PubMed:18941239).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Myd88 (NM_010851) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC204847 Myd88 (untagged) - Mouse myeloid differentiation primary response gene 88 (Myd88), (10ug) 10 ug
$450.00
MG227105 Myd88 (tGFP-tagged) - Mouse myeloid differentiation primary response gene 88 (Myd88), (10ug) 10 ug
$650.00
MR227105L3 Lenti ORF clone of Myd88 (Myc-DDK-tagged) - Mouse myeloid differentiation primary response gene 88 (Myd88) 10 ug
$750.00
MR227105L4 Lenti ORF clone of Myd88 (mGFP-tagged) - Mouse myeloid differentiation primary response gene 88 (Myd88) 10 ug
$750.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.