Cd36 (NM_001159555) Mouse Tagged ORF Clone

SKU
MR226923
Cd36 (Myc-DDK-tagged) - Mouse CD36 antigen (Cd36), transcript variant 3
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cd36
Synonyms FAT; GPIV; Scarb3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR226923 representing NM_001159555
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTGTGATCGGAACTGTGGGCTCATTGCTGGAGCTGTTATTGGTGCAGTCCTGGCTGTGTTTGGAG
GCATTCTCATGCCAGTCGGAGACATGCTTATTGAGAAGACAATCAAAAGGGAAGTTGTCCTTGAAGAAGG
AACCACTGCTTTCAAAAACTGGGTTAAAACAGGCACCACTGTGTACAGACAGTTTTGGATCTTTGATGTG
CAAAACCCAGATGACGTGGCAAAGAACAGCAGCAAAATCAAGGTTAAACAAAGAGGTCCTTACACATACA
GAGTTCGTTATCTAGCCAAGGAAAATATAACTCAGGACCCCGAGGACCACACTGTGTCTTTTGTACAGCC
CAATGGAGCCATCTTTGAGCCTTCACTGTCTGTTGGAACAGAGGATGACAACTTCACAGTTCTGAATCTG
GCTGTAGCAGCTGCACCACATATCTACCAAAATTCATTTGTTCAAGTTGTGCTCAACTCTCTTATAAAAA
AGTCCAAGTCTTCTATGTTCCAAACAAGATCTTTGAAAGAACTCTTGTGGGGTTACAAAGATCCATTCCT
CAGTTTGGTTCCATATCCTATAAGTACCACAGTTGGTGTGTTTTATCCTTACAATGACACTGTAGATGGA
GTTTATAAAGTTTTCAATGGAAAGGATAACATAAGCAAAGTTGCCATAATTGAGTCCTATAAAGGGAAAA
GGAATTTGTCCTATTGGCCAAGCTATTGCGACATGATTAATGGCACAGACGCAGCCTCCTTTCCACCTTT
TGTTGAAAAGTCTCGGACATTGAGATTCTTTTCCTCTGACATTTGCAGGTCTATCTACGCTGTGTTCGGA
TCTGAAATCGACCTTAAAGGAATCCCCGTGTACAGATTTGTTCTTCCAGCCAATGCCTTTGCATCACCCC
TCCAGAATCCAGACAACCATTGTTTCTGCACTGAAAAAGTAATCTCCAATAACTGTACATCTTATGGTGT
GCTAGACATTGGCAAATGCAAAGAAGGAAAGCCTGTGTATATTTCGCTTCCACATTTCCTACATGCAAGT
CCAGATGTTTCAGAACCTATTGAAGGCTTACATCCAAATGAAGATGAGCATAGGACATACTTAGATGTGG
AACCCATAACTGGATTCACTCTACAATTTGCAAAACGACTGCAGGTCAACATATTGGTCAAGCCAGCTAG
AAAAATAGAAGCATTAAAGAATCTGAAGAGACCTTACATTGTACCTATACTGTGGCTAAATGAGACTGGG
ACCATTGGTGATGAAAAAGCAGAAATGTTCAAAACACAAGTGACTGGGAAAATCAAGCTCCTTGGCATGG
TAGAGATGGCCTTACTTGGGATTGGAGTGGTGATGTTTGTTGCTTTTATGATTTCATATTGTGCTTGCAA
ATCCAAGAATGGAAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR226923 representing NM_001159555
Red=Cloning site Green=Tags(s)

MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDMLIEKTIKREVVLEEGTTAFKNWVKTGTTVYRQFWIFDV
QNPDDVAKNSSKIKVKQRGPYTYRVRYLAKENITQDPEDHTVSFVQPNGAIFEPSLSVGTEDDNFTVLNL
AVAAAPHIYQNSFVQVVLNSLIKKSKSSMFQTRSLKELLWGYKDPFLSLVPYPISTTVGVFYPYNDTVDG
VYKVFNGKDNISKVAIIESYKGKRNLSYWPSYCDMINGTDAASFPPFVEKSRTLRFFSSDICRSIYAVFG
SEIDLKGIPVYRFVLPANAFASPLQNPDNHCFCTEKVISNNCTSYGVLDIGKCKEGKPVYISLPHFLHAS
PDVSEPIEGLHPNEDEHRTYLDVEPITGFTLQFAKRLQVNILVKPARKIEALKNLKRPYIVPILWLNETG
TIGDEKAEMFKTQVTGKIKLLGMVEMALLGIGVVMFVAFMISYCACKSKNGK

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001159555
ORF Size 1416 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001159555.1, NP_001153027.1
RefSeq Size 3539 bp
RefSeq ORF 1419 bp
Locus ID 12491
UniProt ID Q08857
Cytogenetics 5 8.11 cM
MW 52.7 kDa
Summary Multifunctional glycoprotein that acts as receptor for a broad range of ligands. Ligands can be of proteinaceous nature like thrombospondin, fibronectin, collagen or amyloid-beta as well as of lipidic nature such as oxidized low-density lipoprotein (oxLDL), anionic phospholipids, long-chain fatty acids and bacterial diacylated lipopeptides (PubMed:7685021). They are generally multivalent and can therefore engage multiple receptors simultaneously, the resulting formation of CD36 clusters initiates signal transduction and internalization of receptor-ligand complexes. The dependency on coreceptor signaling is strongly ligand specific. Cellular responses to these ligands are involved in angiogenesis, inflammatory response, fatty acid metabolism, taste and dietary fat processing in the intestine (Probable) (PubMed:19847289, PubMed:20037584, PubMed:23395392). Binds long-chain fatty acids and facilitates their transport into cells, thus participating in muscle lipid utilization, adipose energy storage, and gut fat absorption (By similarity). In the small intestine, plays a role in proximal absorption of dietary fatty acid and cholesterol for optimal chylomicron formation, possibly through the activation of MAPK1/3 (ERK1/2) signaling pathway (By similarity) (PubMed:17507371, PubMed:18753675, PubMed:21610069). Involved in oral fat perception and preferences (PubMed:16276419). Detection into the tongue of long-chain fatty acids leads to a rapid and sustained rise in flux and protein content of pancreatobiliary secretions (By similarity) (PubMed:16276419). In taste receptor cells, mediates the induction of an increase in intracellular calcium levels by long-chain fatty acids, leading to the activation of the gustatory neurons in the nucleus of the solitary tract (PubMed:18162488). Important factor in both ventromedial hypothalamus neuronal sensing of long-chain fatty acid and the regulation of energy and glucose homeostasis (By similarity) (PubMed:23557700). Receptor for thombospondins, THBS1 and THBS2, mediating their antiangiogenic effects (PubMed:15748999). As a coreceptor for TLR4:TLR6 heterodimer, promotes inflammation in monocytes/macrophages. Upon ligand binding, such as oxLDL or amyloid-beta 42, interacts with the heterodimer TLR4:TLR6, the complex is internalized and triggers inflammatory response, leading to NF-kappa-B-dependent production of CXCL1, CXCL2 and CCL9 cytokines, via MYD88 signaling pathway, and CCL5 cytokine, via TICAM1 signaling pathway, as well as IL1B secretion, through the priming and activation of the NLRP3 inflammasome (PubMed:20037584, PubMed:23812099). Selective and nonredundant sensor of microbial diacylated lipopeptide that signal via TLR2:TLR6 heterodimer, this cluster triggers signaling from the cell surface, leading to the NF-kappa-B-dependent production of TNF, via MYD88 signaling pathway and subsequently is targeted to the Golgi in a lipid-raft dependent pathway (By similarity) (PubMed:15690042, PubMed:19847289).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Cd36 (NM_001159555) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC216434 Cd36 (untagged) - Mouse CD36 antigen (Cd36), transcript variant 3, (10ug) 10 ug
$732.00
MG226923 Cd36 (tGFP-tagged) - Mouse CD36 antigen (Cd36) transcript variant 3, (10ug) 10 ug
$886.00
MR226923L3 Lenti ORF clone of Cd36 (Myc-DDK-tagged) - Mouse CD36 antigen (Cd36), transcript variant 3 10 ug
$986.00
MR226923L4 Lenti ORF clone of Cd36 (mGFP-tagged) - Mouse CD36 antigen (Cd36), transcript variant 3 10 ug
$986.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.