Fasl (NM_010177) Mouse Tagged ORF Clone

SKU
MR226655
Fasl (Myc-DDK-tagged) - Mouse Fas ligand (TNF superfamily, member 6) (Fasl), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Fasl
Synonyms APT1LG1; CD95-L; CD95L; CD178; Fas-L; Faslg; gld; Tnfsf6; Tnlg1a
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR226655 representing NM_010177
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGCAGCCCATGAATTACCCATGTCCCCAGATCTTCTGGGTAGACAGCAGTGCCACTTCATCTTGGG
CTCCTCCAGGGTCAGTTTTTCCCTGTCCATCTTGTGGGCCTAGAGGGCCGGACCAAAGGAGACCGCCACC
TCCACCACCACCTGTGTCACCACTACCACCGCCATCACAACCACTCCCACTGCCGCCACTGACCCCTCTA
AAGAAGAAGGACCACAACACAAATCTGTGGCTACCGGTGGTATTTTTCATGGTTCTGGTGGCTCTGGTTG
GAATGGGATTAGGAATGTATCAGCTCTTCCACCTGCAGAAGGAACTGGCAGAACTCCGTGAGTTCACCAA
CCAAAGCCTTAAAGTATCATCTTTTGAAAAGCAAATAGCCAACCCCAGTACACCCTCTGAAAAAAAAGAG
CCGAGGAGTGTGGCCCATTTAACAGGGAACCCCCACTCAAGGTCCATCCCTCTGGAATGGGAAGACACAT
ATGGAACCGCTCTGATCTCTGGAGTGAAGTATAAGAAAGGTGGCCTTGTGATCAACGAAACTGGGTTGTA
CTTCGTGTATTCCAAAGTATACTTCCGGGGTCAGTCTTGCAACAACCAGCCCCTAAACCACAAGGTCTAT
ATGAGGAACTCTAAGTATCCTGAGGATCTGGTGCTAATGGAGGAGAAGAGGTTGAACTACTGCACTACTG
GACAGATATGGGCCCACAGCAGCTACCTGGGGGCAGTATTCAATCTTACCAGTGCTGACCATTTATATGT
CAACATATCTCAACTCTCTCTGATCAATTTTGAGGAATCTAAGACCTTTTTCGGCTTGTATAAGCTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR226655 representing NM_010177
Red=Cloning site Green=Tags(s)

MQQPMNYPCPQIFWVDSSATSSWAPPGSVFPCPSCGPRGPDQRRPPPPPPPVSPLPPPSQPLPLPPLTPL
KKKDHNTNLWLPVVFFMVLVALVGMGLGMYQLFHLQKELAELREFTNQSLKVSSFEKQIANPSTPSEKKE
PRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVY
MRNSKYPEDLVLMEEKRLNYCTTGQIWAHSSYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_010177
ORF Size 837 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_010177.4, NP_034307.1
RefSeq Size 1935 bp
RefSeq ORF 840 bp
Locus ID 14103
UniProt ID P41047
Cytogenetics 1 69.95 cM
MW 31.9 kDa
Summary Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells (PubMed:7511063). Involved in cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development (PubMed:19794494, PubMed:7532682). Initiates fratricidal/suicidal activation-induced cell death (AICD) in antigen-activated T-cells contributing to the termination of immune responses (PubMed:19794494). TNFRSF6/FAS-mediated apoptosis has also a role in the induction of peripheral tolerance (PubMed:10779162). Binds to TNFRSF6B/DcR3, a decoy receptor that blocks apoptosis (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Fasl (NM_010177) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC208467 Fasl (untagged) - Mouse Fas ligand (TNF superfamily, member 6) (Fasl), transcript variant 1, (10ug) 10 ug
$300.00
MG226655 Fasl (tGFP-tagged) - Mouse Fas ligand (TNF superfamily member 6) (Fasl), (10ug) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
MR226655L3 Lenti ORF clone of Fasl (Myc-DDK-tagged) - Mouse Fas ligand (TNF superfamily, member 6) (Fasl), transcript variant 1 10 ug
$600.00
MR226655L4 Lenti ORF clone of Fasl (mGFP-tagged) - Mouse Fas ligand (TNF superfamily, member 6) (Fasl), transcript variant 1 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.