Bdnf (NM_007540) Mouse Tagged ORF Clone

SKU
MR226614
Bdnf (Myc-DDK-tagged) - Mouse brain derived neurotrophic factor (Bdnf), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Bdnf
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR226614 representing NM_007540
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCCACCAGGTGAGAAGAGTGATGACCATCCTTTTCCTTACTATGGTTATTTCATACTTCGGTTGCA
TGAAGGCGGCGCCCATGAAAGAAGTAAACGTCCACGGACAAGGCAACTTGGCCTACCCAGGTGTGCGGAC
CCATGGGACTCTGGAGAGCGTGAATGGGCCCAGGGCAGGTTCGAGAGGTCTGACGACGACATCACTGGCT
GACACTTTTGAGCACGTCATCGAAGAGCTGCTGGATGAGGACCAGAAGGTTCGGCCCAACGAAGAAAACC
ATAAGGACGCGGACTTGTACACTTCCCGGGTGATGCTCAGCAGTCAAGTGCCTTTGGAGCCTCCTCTACT
CTTTCTGCTGGAGGAATACAAAAATTACCTGGATGCCGCAAACATGTCTATGAGGGTTCGGCGCCACTCC
GACCCTGCCCGCCGTGGGGAGCTGAGCGTGTGTGACAGTATTAGCGAGTGGGTCACAGCGGCAGATAAAA
AGACTGCAGTGGACATGTCTGGCGGGACGGTCACAGTCCTAGAGAAAGTCCCGGTATCCAAAGGCCAACT
GAAGCAGTATTTCTACGAGACCAAGTGTAATCCCATGGGTTACACCAAGGAAGGCTGCAGGGGCATAGAC
AAAAGGCACTGGAACTCGCAATGCCGAACTACCCAATCGTATGTTCGGGCCCTTACTATGGATAGCAAAA
AGAGAATTGGCTGGCGATTCATAAGGATAGACACTTCCTGTGTATGTACACTGACCATTAAAAGGGGAAG
A


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR226614 representing NM_007540
Red=Cloning site Green=Tags(s)

MFHQVRRVMTILFLTMVISYFGCMKAAPMKEVNVHGQGNLAYPGVRTHGTLESVNGPRAGSRGLTTTSLA
DTFEHVIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHS
DPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGID
KRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007540
ORF Size 771 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007540.4, NP_031566.4
RefSeq Size 4302 bp
RefSeq ORF 774 bp
Locus ID 12064
Cytogenetics 2 56.63 cM
MW 29.6 kDa
Summary The protein encoded by this gene is a member of the nerve growth factor family. It is involved in the growth, differentiation and survival of specific types of developing neurons both in the central nervous system (CNS) and the peripheral nervous system. It is also involved in regulating synaptic plasticity in the CNS. Expression of a similar gene in human is reduced in both Alzheimer's and Huntington disease patients. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Oct 2015]
Write Your Own Review
You're reviewing:Bdnf (NM_007540) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MG226614 Bdnf (tGFP-tagged) - Mouse brain derived neurotrophic factor (Bdnf) transcript variant 1, (10ug) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
MR226614L3 Lenti ORF clone of Bdnf (Myc-DDK-tagged) - Mouse brain derived neurotrophic factor (Bdnf), transcript variant 1 10 ug
$600.00
MR226614L4 Lenti ORF clone of Bdnf (mGFP-tagged) - Mouse brain derived neurotrophic factor (Bdnf), transcript variant 1 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.