Srsf9 (NM_025573) Mouse Tagged ORF Clone

SKU
MR226397
Srsf9 (Myc-DDK-tagged) - Mouse serine/arginine-rich splicing factor 9 (Srsf9), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Srsf9
Synonyms 25kDa; 2610029M16Rik; Sf; Sfrs9; SRp; SRp30c
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR226397 representing NM_025573
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGTCGGGCTGGGCGGACGAGCGCGGCGGCGAGGGCGACGGGCGCATCTACGTGGGCAACCTTCCGT
CCGACGTGCGCGAGAAGGACCTCGAGGACTTGTTCTACAAGTACGGCCGCATCCGCGAGATCGAGCTCAA
GAACCGGCACGGCCTCGTGCCCTTCGCCTTCGTGCGCTTCGAGGACCCGCGAGATGCTGAGGATGCGATC
TATGGAAGAAACGGTTACGATTATGGCCAGTGTCGACTCCGTGTGGAGTTCCCCAGGACTTACGGAGGTC
GGGGTGGGTGGCCCCGTGGTGCAAGGAACGGGCCTCCTACAAGACGGTCAGATTTCCGAGTTCTTGTTTC
AGGACTTCCTCCATCAGGCAGCTGGCAGGACCTGAAAGATCACATGCGAGAAGCTGGGGATGTCTGTTAT
GCAGACGTACAGAAGGACGGAATGGGGATGGTTGAATATTTGAGAAAAGAGGACATGGAATATGCTCTGC
GTAAACTGGATGACACCAAATTCCGCTCTCACGAGGGTGAGACTTCCTACATCCGAGTGTATCCTGAGAG
AAGCACCAGCTATGGCTACTCACGGTCGCGGTCTGGGTCCAGGGGCCGCGACTCGCCATACCAAAGCCGG
GGCTCGCCACACTACTTCTCTCCTTTCAGGCCCTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR226397 representing NM_025573
Red=Cloning site Green=Tags(s)

MSSGWADERGGEGDGRIYVGNLPSDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAI
YGRNGYDYGQCRLRVEFPRTYGGRGGWPRGARNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCY
ADVQKDGMGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSR
GSPHYFSPFRPY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_025573
ORF Size 666 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025573.3, NP_079849.1
RefSeq Size 1162 bp
RefSeq ORF 669 bp
Locus ID 108014
UniProt ID Q9D0B0
Cytogenetics 5 F
MW 26.1 kDa
Summary The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants, one protein-coding and the other not protein-coding, have been found for this gene. [provided by RefSeq, Sep 2010]
Write Your Own Review
You're reviewing:Srsf9 (NM_025573) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC212161 Srsf9 (untagged) - Mouse serine/arginine-rich splicing factor 9 (Srsf9), transcript variant 1, (10ug) 10 ug
$330.00
MG226397 Srsf9 (tGFP-tagged) - Mouse serine/arginine-rich splicing factor 9 (Srsf9) transcript variant 1, (10ug) 10 ug
$500.00
MR226397L3 Lenti ORF clone of Srsf9 (Myc-DDK-tagged) - Mouse serine/arginine-rich splicing factor 9 (Srsf9), transcript variant 1 10 ug
$600.00
MR226397L4 Lenti ORF clone of Srsf9 (mGFP-tagged) - Mouse serine/arginine-rich splicing factor 9 (Srsf9), transcript variant 1 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.