Efna5 (NM_010109) Mouse Tagged ORF Clone
SKU
MR226358
Efna5 (Myc-DDK-tagged) - Mouse ephrin A5 (Efna5), transcript variant 2
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Mouse Tagged ORF Clone |
---|---|
Target Symbol | Efna5 |
Synonyms | AL-1; AV158822; EFL-5; Ephrin-A5; Epl7; LERK-7; RAGS |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>MR226358 representing NM_010109
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTTGCACGTGGAGATGTTGACGCTGCTCTTTCTGGTGCTCTGGATGTGTGTGTTCAGCCAGGACCCGG GCTCCAAAGTCGTCGCCGACCGCTACGCCGTCTACTGGAACAGCAGCAACCCCAGATTCCAGAGGGGTGA CTACCACATTGATGTCTGTATCAATGACTACCTGGATGTTTTCTGCCCTCACTATGAGGACTCTGTCCCA GAAGACAAGACTGAGCGCTACGTCCTGTACATGGTGAATTTTGATGGGTACAGTGCCTGCGACCACACGT CCAAAGGGTTCAAGAGATGGGAATGTAACCGGCCTCACTCCCCAAACGGACCGCTGAAGTTCTCGGAAAA ATTCCAGCTCTTCACTCCCTTTTCTTTAGGATTTGAATTCAGGCCAGGCCGAGAGTATTTCTACATCTCC TCTGCAATCCCAGACAACGGAAGAAGGTCCTGTCTAAAGCTCAAAGTCTTTGTGAGACCAACAAATGACA CCGTACATGAGTCAGCCGAGCCATCCCGCGGTGAGAACGCGGCGCAGACACCAAGGATACCCAGCCGCCT TTTGGCAATCCTACTGTTCCTCCTGGCGATGCTTTTGACATTA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR226358 representing NM_010109
Red=Cloning site Green=Tags(s) MLHVEMLTLLFLVLWMCVFSQDPGSKVVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVP EDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYIS SAIPDNGRRSCLKLKVFVRPTNDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL myc-FLAG tag |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_010109 |
ORF Size | 603 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_010109.3, NP_034239.1 |
RefSeq Size | 5178 bp |
RefSeq ORF | 606 bp |
Locus ID | 13640 |
UniProt ID | O08543 |
Cytogenetics | 17 32.57 cM |
MW | 23.8 kDa |
Summary | Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase. Activates the EPHA3 receptor to regulate cell-cell adhesion and cytoskeletal organization. With the receptor EPHA2 may regulate lens fiber cells shape and interactions and be important for lens transparency maintenance. May function actively to stimulate axon fasciculation. The interaction of EFNA5 with EPHA5 also mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Cognate/functional ligand for EPHA7, their interaction regulates brain development modulating cell-cell adhesion and repulsion.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
MC208425 | Efna5 (untagged) - Mouse ephrin A5 (Efna5), transcript variant 2, (10ug) | 10 ug |
$330.00
|
|
MG226358 | Efna5 (tGFP-tagged) - Mouse ephrin A5 (Efna5) transcript variant 2, (10ug) | 10 ug |
$530.00
|
|
MR226358L3 | Lenti ORF clone of Efna5 (Myc-DDK-tagged) - Mouse ephrin A5 (Efna5), transcript variant 2 | 10 ug |
$630.00
|
|
MR226358L4 | Lenti ORF clone of Efna5 (mGFP-tagged) - Mouse ephrin A5 (Efna5), transcript variant 2 | 10 ug |
$630.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.