Lpar1 (NM_010336) Mouse Tagged ORF Clone

SKU
MR226281
Lpar1 (Myc-DDK-tagged) - Mouse lysophosphatidic acid receptor 1 (Lpar1), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Lpar1
Synonyms AI326300; Edg2; Gpcr26; Kdt2; lpA1; vzg-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR226281 representing NM_010336
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGCTGCCTCTACTTCCAGCCCTGTAATTTCACAGCCCCAGTTCACAGCCATGAACGAACAACAGT
GCTTCTACAATGAGTCTATCGCCTTCTTTTATAACCGGAGTGGGAAATATCTAGCCACAGAATGGAACAC
AGTGAGCAAGCTGGTGATGGGACTGGGCATCACTGTTTGCGTGTTCATCATGTTGGCCAATCTCCTGGTC
ATGGTGGCAATCTACGTCAACCGCCGCTTCCATTTCCCTATTTATTACTTGATGGCCAACCTGGCTGCTG
CAGACTTCTTCGCTGGATTGGCCTACTTCTACCTGATGTTCAATACAGGACCTAATACCCGGAGACTGAC
TGTTAGCACGTGGCTCCTCCGGCAGGGCCTCATTGACACCAGCCTGACAGCTTCTGTGGCCAACCTGCTG
GCTATTGCTATCGAGAGGCACATCACGGTTTTCCGCATGCAGCTCCATACACGAATGAGCAACCGGCGCG
TGGTGGTGGTGATTGTAGTCATCTGGACTATGGCCATTGTGATGGGTGCTATACCCAGTGTGGGCTGGAA
CTGCATCTGTGATATCGATCACTGTTCCAACATGGCACCCCTCTACAGTGACTCCTACTTAGTCTTCTGG
GCCATTTTCAACCTGGTGACCTTTGTGGTCATGGTGGTTCTCTACGCTCACATCTTTGGCTATGTTCGCC
AGAGGACTATGAGGATGTCTCGGCATAGTTCTGGACCCAGGAGGAATCGGGACACCATGATGAGCCTTCT
GAAGACTGTGGTCATTGTGCTTGGTGCCTTTATTGTCTGCTGGACTCCGGGATTGGTCTTGTTATTGCTG
GATGTGTGCTGCCCGCAGTGCGATGTCCTGGCCTATGAGAAGTTCTTCCTCCTCCTGGCCGAGTTCAACT
CTGCTATGAACCCCATCATCTACTCCTACCGCGACAAAGAGATGAGCGCCACCTTCAGGCAGATCCTGTG
TTGCCAGCGCAACGAGAACCCTAATGGCCCCACGGAAGGCTCTGACCGCTCTGCCTCCTCCCTCAACCAC
ACCATTCTGGCTGGAGTTCACAGCAACGACCACTCTGTGGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR226281 representing NM_010336
Red=Cloning site Green=Tags(s)

MAAASTSSPVISQPQFTAMNEQQCFYNESIAFFYNRSGKYLATEWNTVSKLVMGLGITVCVFIMLANLLV
MVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLL
AIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIDHCSNMAPLYSDSYLVFW
AIFNLVTFVVMVVLYAHIFGYVRQRTMRMSRHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLL
DVCCPQCDVLAYEKFFLLLAEFNSAMNPIIYSYRDKEMSATFRQILCCQRNENPNGPTEGSDRSASSLNH
TILAGVHSNDHSVV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_010336
ORF Size 1092 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_010336.2, NP_034466.2
RefSeq Size 3362 bp
RefSeq ORF 1095 bp
Locus ID 14745
UniProt ID P61793
Cytogenetics 4 32.2 cM
MW 41.6 kDa
Summary Receptor for lysophosphatidic acid (LPA) (PubMed:11087877, PubMed:18066075). Plays a role in the reorganization of the actin cytoskeleton, cell migration, differentiation and proliferation, and thereby contributes to the responses to tissue damage and infectious agents. Activates downstream signaling cascades via the G(i)/G(o), G(12)/G(13), and G(q) families of heteromeric G proteins (PubMed:8922387, PubMed:9600933, PubMed:11040035, PubMed:18157949, PubMed:18066075, PubMed:23478264). Signaling inhibits adenylyl cyclase activity and decreases cellular cAMP levels (PubMed:11040035, PubMed:12215548). Signaling triggers an increase of cytoplasmic Ca(2+) levels (PubMed:12215548). Activates RALA; this leads to the activation of phospholipase C (PLC) and the formation of inositol 1,4,5-trisphosphate (PubMed:11040035, PubMed:12215548, PubMed:23478264). Signaling mediates activation of down-stream MAP kinases (PubMed:11040035). Contributes to the regulation of cell shape (PubMed:8922387, PubMed:9600933, PubMed:11040035, PubMed:11087877). Promotes Rho-dependent reorganization of the actin cytoskeleton in neuronal cells and neurite retraction (PubMed:9600933, PubMed:11040035, PubMed:12181339). Promotes the activation of Rho and the formation of actin stress fibers (PubMed:9600933, PubMed:12215548). Promotes formation of lamellipodia at the leading edge of migrating cells via activation of RAC1 (PubMed:23478264). Through its function as lysophosphatidic acid receptor, plays a role in chemotaxis and cell migration, including responses to injury and wounding (PubMed:11087877, PubMed:18066075, PubMed:23478264). Plays a role in triggering inflammation in response to bacterial lipopolysaccharide (LPS) via its interaction with CD14 (PubMed:21821728). Promotes cell proliferation in response to lysophosphatidic acid (PubMed:9600933, PubMed:11087877, PubMed:12215548, PubMed:18157949, PubMed:17692995, PubMed:23478264). Required for normal skeleton development (PubMed:21569876). May play a role in osteoblast differentiation (PubMed:21569876). Required for normal brain development (PubMed:17656621, PubMed:18708146). Required for normal proliferation, survival and maturation of newly formed neurons in the adult dentate gyrus (PubMed:18708146). Plays a role in pain perception and in the initiation of neuropathic pain (PubMed:15195086, PubMed:19689455).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Lpar1 (NM_010336) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC202097 Lpar1 (untagged) - Mouse lysophosphatidic acid receptor 1 (Lpar1), transcript variant 1, (10ug) 10 ug
$686.00
MG205601 Lpar1 (tGFP-tagged) - Mouse endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, 2 (Edg2) 10 ug
$886.00
MG226281 Lpar1 (tGFP-tagged) - Mouse lysophosphatidic acid receptor 1 (Lpar1) transcript variant 1, (10ug) 10 ug
$886.00
MR226281L3 Lenti ORF clone of Lpar1 (Myc-DDK-tagged) - Mouse lysophosphatidic acid receptor 1 (Lpar1), transcript variant 1 10 ug
$986.00
MR226281L4 Lenti ORF clone of Lpar1 (mGFP-tagged) - Mouse lysophosphatidic acid receptor 1 (Lpar1), transcript variant 1 10 ug
$986.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.