Hcst (NM_011827) Mouse Tagged ORF Clone

SKU
MR226262
Hcst (Myc-DDK-tagged) - Mouse hematopoietic cell signal transducer (Hcst)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Hcst
Synonyms DAP10; KAP10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR226262 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCCCCCAGGCTACCTCCTGTTCCTGCTTCTGCTCCCAGTGGCTGCAAGTCAGACATCGGCAGGTT
CCTGCTCCGGATGTGGGACTCTGTCTCTGCCACTCCTGGCAGGCCTAGTGGCTGCAGATGCGGTCATGTC
ACTCCTAATTGTAGGGGTGGTGTTTGTATGTATGCGCCCACACGGCAGGCCTGCCCAAGAAGATGGTAGA
GTCTACATCAACATGCCTGGCAGAGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR226262 protein sequence
Red=Cloning site Green=Tags(s)

MDPPGYLLFLLLLPVAASQTSAGSCSGCGTLSLPLLAGLVAADAVMSLLIVGVVFVCMRPHGRPAQEDGR
VYINMPGRG

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_011827
ORF Size 237 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_011827.3, NP_035957.2
RefSeq Size 452 bp
RefSeq ORF 240 bp
Locus ID 23900
UniProt ID Q9QUJ0
Cytogenetics 7 17.45 cM
MW 8.1 kDa
Summary Transmembrane adapter protein which associates with KLRK1 to form an activation receptor KLRK1-HCST in lymphoid and myeloid cells; this receptor plays a major role in triggering cytotoxicity against target cells expressing cell surface ligands such as MHC class I chain-related MICA and MICB, and UL16-binding proteins (ULBPs); these ligands are up-regulated by stress conditions and pathological state such as viral infection and tumor transformation. Functions as docking site for PI3-kinase PIK3R1 and GRB2. Interaction of ULBPs with KLRK1-HCST triggers calcium mobilization and activation of the PIK3R1, MAP2K/ERK, and JAK2/STAT5 signaling pathways. Both PIK3R1 and GRB2 are required for full KLRK1-HCST-mediated activation and ultimate killing of target cells. In NK cells, KLRK1-HCST signaling directly induces cytotoxicity and enhances cytokine production initiated via DAP12/TYROBP-associated receptors. In T-cells, it provides primarily costimulation for TCR-induced signals. KLRK1-HCST receptor plays a role in immune surveillance against tumors and is required for cytolysis of tumors cells; indeed, melanoma cells that do not express KLRK1 ligands escape from immune surveillance mediated by NK cells.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Hcst (NM_011827) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC209680 Hcst (untagged) - Mouse hematopoietic cell signal transducer (Hcst), (10ug) 10 ug
$150.00
MG226262 Hcst (tGFP-tagged) - Mouse hematopoietic cell signal transducer (Hcst), (10ug) 10 ug
$350.00
MR226262L3 Lenti ORF clone of Hcst (Myc-DDK-tagged) - Mouse hematopoietic cell signal transducer (Hcst) 10 ug
$450.00
MR226262L4 Lenti ORF clone of Hcst (mGFP-tagged) - Mouse hematopoietic cell signal transducer (Hcst) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.