Ngfr (NM_033217) Mouse Tagged ORF Clone

SKU
MR226206
Ngfr (Myc-DDK-tagged) - Mouse nerve growth factor receptor (TNFR superfamily, member 16) (Ngfr)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ngfr
Synonyms LNGFR; p75; p75NGFR; p75NTR; Tnfrsf16
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR226206 representing NM_033217
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGAGGGCAGGTGCTGCCTGCAGCGCCATGGACCGGCTGCGCCTGCTGCTGCTGCTGCTGCTGCTTC
TAGGGGTGTCCTTTGGAGGTGCCAAGGAGACATGTTCCACAGGCATGTACACCCACAGTGGAGAGTGCTG
CAAAGCCTGCAACCTGGGCGAAGGTGTGGCCCAGCCTTGCGGAGCCAACCAGACCGTGTGTGAACCCTGC
CTGGACAGTGTTACGTTCTCTGACGTGGTGAGCGCCACCGAGCCGTGCAAGCCGTGCACCGAGTGCCTGG
GCCTGCAGAGTATGTCCGCTCCCTGTGTGGAGGCAGACGATGCCGTGTGCCGATGCTCCTATGGCTACTA
CCAGGACGAGGAGACTGGCCGCTGCGAGGCTTGCAGCGTGTGCGGGGTGGGCTCAGGACTCGTGTTCTCC
TGCCAGGACAAACAGAACACAGTGTGTGAAGAGTGCCCAGAGGGCACATACTCAGATGAAGCCAACCACG
TGGACCCGTGCCTACCCTGCACGGTGTGCGAGGACACTGAGCGCCAGTTACGCGAGTGCACGCCCTGGGC
TGACGCCGAATGCGAGGAGATCCCTGGCCGATGGATCACAAGGTCTACGCCCCCGGAGGGCTCTGACGTC
ACAACACCCAGCACCCAGGAGCCGGAGGCACCTCCAGAGCGAGACCTCATAGCCAGCACAGTGGCCGATA
CGGTGACCACTGTGATGGGCAGCTCCCAGCCTGTAGTGACCCGAGGCACCGCTGACAACCTCATTCCTGT
CTATTGCTCCATCTTGGCTGCTGTGGTTGTGGGCCTTGTGGCCTATATTGCTTTCAAGAGATGGAACAGC
TGCAAGCAAAATAAACAAGGAGCCAACAGCCGGCCGGTGAACCAGACACCCCCACCAGAGGGAGAGAAAC
TGCACAGCGACAGCGGCATCTCTGTGGACAGCCAGAGCCTGCACGACCAGCAGACCCACACACAGACTGC
CTCAGGCCAAGCCCTCAAGGGTGATGGCAACCTCTACAGTAGCCTGCCCCTGACCAAGCGTGAGGAGGTC
GAGAAGCTGCTCAATGGTGACACCTGGCGACATCTGGCAGGCGAGCTGGGCTACCAGCCGGAGCATATAG
ACTCCTTTACCCACGAGGCCTGCCCAGTCCGAGCCCTGCTGGCCAGCTGGGGTGCCCAGGACAGCGCGAC
GCTCGATGCCCTTTTAGCCGCCCTGCGACGCATCCAGAGAGCTGACATTGTGGAGAGCCTGTGCAGCGAG
TCCACTGCCACGTCCCCTGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR226206 representing NM_033217
Red=Cloning site Green=Tags(s)

MRRAGAACSAMDRLRLLLLLLLLLGVSFGGAKETCSTGMYTHSGECCKACNLGEGVAQPCGANQTVCEPC
LDSVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCSYGYYQDEETGRCEACSVCGVGSGLVFS
CQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQLRECTPWADAECEEIPGRWITRSTPPEGSDV
TTPSTQEPEAPPERDLIASTVADTVTTVMGSSQPVVTRGTADNLIPVYCSILAAVVVGLVAYIAFKRWNS
CKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEV
EKLLNGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSE
STATSPV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_033217
ORF Size 1281 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_033217.3, NP_150086.2
RefSeq Size 3409 bp
RefSeq ORF 1284 bp
Locus ID 18053
UniProt ID Q9Z0W1
Cytogenetics 11 59.01 cM
MW 45.6 kDa
Summary Low affinity neurotrophin receptor which can bind to mature NGF, BDNF, NTF3, and NTF4 (PubMed:11559852, PubMed:1317267). Forms a heterodimeric receptor with SORCS2 that binds the precursor forms of NGF (proNGF), BDNF (proBDNF) and NTF3 (proNT3) with high affinity, and has much lower affinity for mature NGF and BDNF (PubMed:22155786, PubMed:24908487, PubMed:27457814). Plays an important role in differentiation and survival of specific neuronal populations during development (PubMed:1317267, PubMed:11559852). Can mediate cell survival as well as cell death of neural cells (PubMed:1317267, PubMed:11559852, PubMed:24908487). The heterodimeric receptor formed with SORCS2 plays a role in proBDNF-dependent synaptic plasticity, in hippocampal long term depression (LTD) and long term potentiation (LTP) (PubMed:27457814). Plays a role in the inactivation of RHOA (By similarity). Plays a role in the regulation of the translocation of GLUT4 to the cell surface in adipocytes and skeletal muscle cells in response to insulin, probably by regulating RAB31 activity, and thereby contributes to the regulation of insulin-dependent glucose uptake (PubMed:22460790). Necessary for the circadian oscillation of the clock genes ARNTL/BMAL1, PER1, PER2 and NR1D1 in the suprachiasmatic nucleus (SCN) of the brain and in liver and of the genes involved in glucose and lipid metabolism in the liver (PubMed:23785138).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Ngfr (NM_033217) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC209033 Ngfr (untagged) - Mouse nerve growth factor receptor (TNFR superfamily, member 16) (Ngfr), (10ug) 10 ug
$686.00
MG226206 Ngfr (tGFP-tagged) - Mouse nerve growth factor receptor (TNFR superfamily member 16) (Ngfr), (10ug) 10 ug
$886.00
MR226206L1 Lenti ORF clone of Ngfr (Myc-DDK-tagged) - Mouse nerve growth factor receptor (TNFR superfamily, member 16) (Ngfr) 10 ug
$986.00
MR226206L2 Lenti ORF clone of Ngfr (mGFP-tagged) - Mouse nerve growth factor receptor (TNFR superfamily, member 16) (Ngfr) 10 ug
$986.00
MR226206L3 Lenti ORF clone of Ngfr (Myc-DDK-tagged) - Mouse nerve growth factor receptor (TNFR superfamily, member 16) (Ngfr) 10 ug
$986.00
MR226206L4 Lenti ORF clone of Ngfr (mGFP-tagged) - Mouse nerve growth factor receptor (TNFR superfamily, member 16) (Ngfr) 10 ug
$986.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.