Ube2e3 (NM_009454) Mouse Tagged ORF Clone

SKU
MR226136
Ube2e3 (Myc-DDK-tagged) - Mouse ubiquitin-conjugating enzyme E2E 3, UBC4/5 homolog (yeast) (Ube2e3)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ube2e3
Synonyms Ubce4; ubcM2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR226136 representing NM_009454
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCAGTGACAGGCAAAGGTCGGATGATGAGAGCCCTAGCACCAGCAGTGGCAGTTCAGATGCAGATC
AGCGAGACCCTGCCGCTCCAGAGCCCGAGGAACAGGAAGAAAGAAAACCTTCTGCCACCCAGCAGAAGAA
AAACACCAAACTCTCTAGCAAAACGACTGCTAAGTTATCCACTAGTGCTAAAAGAATTCAGAAGGAGCTA
GCAGAGATAACCCTTGATCCTCCTCCTAACTGCAGTGCTGGGCCTAAAGGAGATAACATTTATGAATGGA
GGTCAACTATACTTGGTCCACCAGGTTCTGTATATGAAGGTGGTGTTTTTTTTCTGGATATCACATTTTC
TTCAGATTATCCATTTAAGCCACCAAAGGTTACTTTCCGTACCAGAATCTATCACTGCAACATCAACAGT
CAGGGAGTCATCTGCCTGGATATTCTGAAAGACAACTGGAGTCCTGCTTTGACTATTTCAAAGGTTTTGC
TCTCTATTTGTTCCCTTTTGACAGATTGCAACCCTGCGGATCCTCTGGTCGGAAGCATAGCCACTCAGTA
TTTGACCAACAGAGCAGAACATGACAGGATAGCCAGACAGTGGACCAAGAGATACGCAACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR226136 representing NM_009454
Red=Cloning site Green=Tags(s)

MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKEL
AEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINS
QGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_009454
ORF Size 621 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_009454.2, NP_033480.1
RefSeq Size 1562 bp
RefSeq ORF 624 bp
Locus ID 22193
UniProt ID P52483
Cytogenetics 2 C3
MW 23.4 kDa
Summary Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination (By similarity). Participates in the regulation of transepithelial sodium transport in renal cells. May be involved in cell growth arrest.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Ube2e3 (NM_009454) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MG226136 Ube2e3 (tGFP-tagged) - Mouse ubiquitin-conjugating enzyme E2E 3 UBC4/5 homolog (yeast) (Ube2e3), (10ug) 10 ug
$500.00
MR226136L3 Lenti ORF clone of Ube2e3 (Myc-DDK-tagged) - Mouse ubiquitin-conjugating enzyme E2E 3, UBC4/5 homolog (yeast) (Ube2e3) 10 ug
$600.00
MR226136L4 Lenti ORF clone of Ube2e3 (mGFP-tagged) - Mouse ubiquitin-conjugating enzyme E2E 3, UBC4/5 homolog (yeast) (Ube2e3) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.