Cldn11 (NM_008770) Mouse Tagged ORF Clone

SKU
MR225523
Cldn11 (Myc-DDK-tagged) - Mouse claudin 11 (Cldn11)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cldn11
Synonyms Claudin-11; Claudin11; Osp; Ot; Otm
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR225523 representing NM_008770
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTAGCCACTTGCCTTCAGGTGGTGGGTTTCGTCACGAGCTTCGTGGGTTGGATTGGCATCATCGTCA
CAACGTCCACCAATGACTGGGTGGTGACCTGCAGCTACACCATCCCCACCTGCCGAAAAATGGACGAACT
GGGCTCCAAGGGCCTGTGGGCTGACTGCGTCATGGCCACTGGTCTCTACCACTGCAAACCCCTGGTGGAC
ATCCTCATCCTTCCAGGCTACGTGCAGGCTTGTAGAGCCCTCATGATTGCTGCCTCCGTTCTGGGCCTGC
CCGCCATCTTGCTGCTGTTGACAGTTCTCCCCTGCATCCGAATGGGCCACGAGCCTGGAGTGGCCAAGTA
CAGGCGAGCCCAGCTGGCTGGGGTGCTCCTTATTCTGCTGGCTCTCTGCGCCATTGTCGCCACCATCTGG
TTTCCTGTATGTGCCCACCGCGAGATCACCATCGTGAGCTTTGGCTACTCGCTGTACGCAGGTTGGATCG
GTGCTGTGATGTGCCTGGTGGGTGGCTGTGTCATCGTCTGCTGCTCCGGGGATGCACAGTCATTTGGAGA
AAACCGTTTCTATTACTCTTCTGGTTCCAGCTCGCCAACGCATGCCAAGAGTGCCCATGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR225523 representing NM_008770
Red=Cloning site Green=Tags(s)

MVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCSYTIPTCRKMDELGSKGLWADCVMATGLYHCKPLVD
ILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRRAQLAGVLLILLALCAIVATIW
FPVCAHREITIVSFGYSLYAGWIGAVMCLVGGCVIVCCSGDAQSFGENRFYYSSGSSSPTHAKSAHV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_008770
ORF Size 621 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_008770.3, NP_032796.1
RefSeq Size 1872 bp
RefSeq ORF 624 bp
Locus ID 18417
UniProt ID Q60771
Cytogenetics 3 15.14 cM
MW 22.6 kDa
Summary This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The protein encoded by this gene is a major component of CNS (central nervous system) myelin and plays an important role in regulating proliferation and migration of oligodendrocytes. The basal cell tight junctions in stria vascularis are primarily composed of this protein, and the gene-null mice suffer severe deafness. This protein is also an obligatory protein for tight junction formation and barrier integrity in the testis and the gene deficiency results in loss of the Sertoli cell epithelial phenotype in the testis. [provided by RefSeq, Aug 2010]
Write Your Own Review
You're reviewing:Cldn11 (NM_008770) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MG225523 Cldn11 (tGFP-tagged) - Mouse claudin 11 (Cldn11), (10ug) 10 ug
$500.00
MR225523L3 Lenti ORF clone of Cldn11 (Myc-DDK-tagged) - Mouse claudin 11 (Cldn11) 10 ug
$600.00
MR225523L4 Lenti ORF clone of Cldn11 (mGFP-tagged) - Mouse claudin 11 (Cldn11) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.