Crkl (NM_007764) Mouse Tagged ORF Clone

CAT#: MR225132

Crkl (Myc-DDK-tagged) - Mouse v-crk sarcoma virus CT10 oncogene homolog (avian)-like (Crkl)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 219.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Crkl (NM_007764) Mouse Tagged ORF Clone
Symbol Crkl
Synonyms 1110025F07Rik; AA589403; AI325100; Crkol
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR225132 representing NM_007764
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTCCGCCAGGTTTGATTCTTCAGACCGCTCTGCCTGGTACATGGGGCCAGTGACTCGCCAGGAGG
CGCAGACTCGTCTCCAAGGCCAGCGCCATGGCATGTTCCTAGTCCGGGACTCATCTACCTGCCCCGGGGA
CTATGTACTGTCCGTGTCCGAGAACTCGCGTGTCTCGCACTACATCATCAACTCCCTGCCCAACCGCCGC
TTTAAGATCGGGGACCAGGAGTTTGACCATTTGCCGGCCTTGTTAGAGTTCTACAAGATCCACTACCTGG
ACACTACCACCTTAATCGAACCGGCGCCCAGGTACCCAAGCCCACCAGTGGGTTCTGTCTCAGCACCCAA
CTTACCTACAGCAGAAGAAAATCTGGAATATGTACGGACCCTTTATGATTTTCCTGGGAATGATGCTGAA
GACCTACCCTTTAAAAAGGGCGAGCTTCTAGTGATAATAGAAAAGCCTGAAGAGCAGTGGTGGAGTGCCC
GCAACAAGGACGGCCGGGTTGGGATGATTCCTGTCCCTTACGTTGAAAAGCTTGTGAGGTCTTCGCCACA
TGGAAAGCATGGAAATAGGAATTCTAACAGTTATGGCATCCCAGAACCTGCTCATGCGTATGCTCAACCT
CAGACCACAACTCCTCTACCTACAGTTGCCAGTACTCCTGGGGCAGCGATCAACCCTTTGCCATCCACAC
AGAATGGACCTGTCTTTGCAAAAGCAATCCAGAAGAGAGTACCTTGTGCTTATGACAAGACTGCCTTGGC
ATTGGAGGTTGGTGACATTGTGAAAGTCACAAGGATGAATATCAATGGCCAATGGGAAGGCGAGGTGAAT
GGGCGCAAGGGGCTTTTCCCCTTCACACATGTTAAAATCTTTGACCCTCAGAACCCCGATGACAACGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR225132 representing NM_007764
Red=Cloning site Green=Tags(s)

MSSARFDSSDRSAWYMGPVTRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRR
FKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPVGSVSAPNLPTAEENLEYVRTLYDFPGNDAE
DLPFKKGELLVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQP
QTTTPLPTVASTPGAAINPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVN
GRKGLFPFTHVKIFDPQNPDDNE

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_007764
ORF Size 909 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007764.1, NM_007764.2, NM_007764.3, NM_007764.4, NM_007764.5, NP_031790
RefSeq Size 3863
RefSeq ORF 912
Locus ID 12929
Cytogenetics 16|16 A3
MW 34.3 kDa
Gene Summary This gene is part of a family of adapter proteins that mediate formation of signal transduction complexes in response to extracellular stimuli, such as growth and differentiation factors. Protein-protein interactions occur through the SH2 domain, which binds phosphorylated tyrosine residues, and the SH3 domain, which binds proline-rich peptide motifs. These interactions promote recruitment and activation of effector proteins to regulate cell migration, adhesion, and proliferation. In certain mouse genetic backgrounds this protein is essential for embryonic development. It is important for neural crest cell differentiation and survival and is proposed to play an important role in transducing the oncogenic signal of Bcr/Abl. Deletion of this gene in mouse mimics the phenotype of DiGeorge/velocardiofacial syndrome in human. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Mar 2013].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)