Ms4a3 (NM_133246) Mouse Tagged ORF Clone

SKU
MR225017
Ms4a3 (Myc-DDK-tagged) - Mouse membrane-spanning 4-domains, subfamily A, member 3 (Ms4a3)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ms4a3
Synonyms HTm4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR225017 representing NM_133246
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCCAGAGGAGACTGGTGGTTCTGTTTATCAGCCCTTGGATGAGTCACGCCATGTTCAACGAGGTG
TACTGCAAGCCCTCGGGGCCATCCAGATCCTGAATGGAATACTGATTCTAGCTCTCGGAATTTTTCTGGT
TTGTTTACAACACGTGTCCCACCACTTCAGGCATTTCTTCTTCTTCACCTTCTACACAGGCTACCCACTG
TGGGGTGCTGTGTTTTTTATCAGCTCAGGATCCTTGACTGTTGCCGCAGGGAGAAACCCCACACGAATGC
TGATGCAAAACAGTTTTGGGATAAACATTGCCAGTACTACAATTGCATTTGTTGGGACTGTTTTCCTTTC
TGTGCATTTGGCATTCAATACCCAGGCTTTCAAGGGTTGCCAATCTTCACCGTCACCTGATGTCTGCATT
TCCCTGGGTTCCTCATCAGATGGCCTGGTGTCTTTAATGCTGATTCTCACCCTGCTGGAGCTGTCCGTGA
CCATTTCTATCTCTGCCATGTGGTGCTTGGGAAATGTTTGTGGTTTAAGAGAGGCAATTACTTCACCTCC
TAATTCTGTGGAGTCAGGAATACTTCCTGAAGGAAGTGATTCTGAGAACCTGAACACTCAGCCCCAAGCT
TCAGAAGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR225017 representing NM_133246
Red=Cloning site Green=Tags(s)

MKPEETGGSVYQPLDESRHVQRGVLQALGAIQILNGILILALGIFLVCLQHVSHHFRHFFFFTFYTGYPL
WGAVFFISSGSLTVAAGRNPTRMLMQNSFGINIASTTIAFVGTVFLSVHLAFNTQAFKGCQSSPSPDVCI
SLGSSSDGLVSLMLILTLLELSVTISISAMWCLGNVCGLREAITSPPNSVESGILPEGSDSENLNTQPQA
SEE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_133246
ORF Size 639 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_133246.5, NP_573509.1
RefSeq Size 1012 bp
RefSeq ORF 642 bp
Locus ID 170813
UniProt ID Q920C4
Cytogenetics 19 A
MW 23.3 kDa
Summary Summary:This gene encodes a member of the membrane-spanning-four (MS4) protein group, that contain a four-transmembrane protein structure. This gene is expressed in developing hematopoietic cells and has also been observed in some regions of the adult brain. Expression of the human ortholog of this gene has also been observed in some human cancer cell lines. This protein may play a role in cell cycle regulation, and interactions have been demonstrated between Ms4a3 and KAP phosphatase. [provided by RefSeq, Jul 2014]
Write Your Own Review
You're reviewing:Ms4a3 (NM_133246) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC212342 Ms4a3 (untagged) - Mouse membrane-spanning 4-domains, subfamily A, member 3 (Ms4a3), (10ug) 10 ug
$330.00
MG225017 Ms4a3 (tGFP-tagged) - Mouse membrane-spanning 4-domains subfamily A member 3 (Ms4a3), (10ug) 10 ug
$500.00
MR225017L3 Lenti ORF clone of Ms4a3 (Myc-DDK-tagged) - Mouse membrane-spanning 4-domains, subfamily A, member 3 (Ms4a3) 10 ug
$600.00
MR225017L4 Lenti ORF clone of Ms4a3 (mGFP-tagged) - Mouse membrane-spanning 4-domains, subfamily A, member 3 (Ms4a3) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.