Espn (NM_019585) Mouse Tagged ORF Clone

SKU
MR224961
Espn (Myc-DDK-tagged) - Mouse espin (Espn), transcript variant 6
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Espn
Synonyms je
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR224961 representing NM_019585
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACTCCCAGGGGCCTCTAGGTGGGGGCCATATACCCAGCACCAAATCTTTCAACATGATGTCCCCAA
CGGGTGATAACTCAGAGCTTCTGGCTGAGATAAAGGCGGGCAAGAGCCTGAAGCCGACACCGCAGAGCAA
GGGGCTGACAACCGTGTTCTCAGGCAGTGGGCAGCCAGCCTCCCAGGTAGGCACTGGCCGAGTGCCCCGC
CCGGGCTCCCAGTGCCTGCCCAGTGCTCAGCCCTACTGCTTCTCCCGGCAGCCTGAGTCACCGCAGCCTC
TGGTGTCACCTGCGCCATCTCGGACTCGGAGCCCCACCCCGCCAGCCTCTGGGTCTCAGCCACTGCTCAA
TGGCAGTGTGGTGCCGGCACCACCTGCCACCCCGGCACCTGGAGTCCATCTGGATGTGGAGGCCCTCATT
CCCACTCTTGATGAGCAGGGCCGGCCCATCCCGGAGTGGAAGCGCCAGGTGATGGTCCGCAAGCTGCAGC
AGAAGATGCAGGAGGAAGAGGAGCAGCGGAGGAAGGAGGAAGAGGAGGAGGCCCGGCTCGCCAGCCTGCC
TGCCTGGAGACGAGACATTCTTCGGAAGAAGCTGGAGGAGGAGAGGGAGCAGAAGCGAAAAGAGGAGGAG
CGGCAAAAGCTGGAGGAAATACAGAGGGCGAAAGAACAGTCGGAGAAGCTGCGGACACTAGGCTACGACG
AAGCCAAGCTCGCGCCCTGGCAGCGACAGGTCATCTTGAAGAAGGGGGAGATCCCTAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR224961 representing NM_019585
Red=Cloning site Green=Tags(s)

MNSQGPLGGGHIPSTKSFNMMSPTGDNSELLAEIKAGKSLKPTPQSKGLTTVFSGSGQPASQVGTGRVPR
PGSQCLPSAQPYCFSRQPESPQPLVSPAPSRTRSPTPPASGSQPLLNGSVVPAPPATPAPGVHLDVEALI
PTLDEQGRPIPEWKRQVMVRKLQQKMQEEEEQRRKEEEEEARLASLPAWRRDILRKKLEEEREQKRKEEE
RQKLEEIQRAKEQSEKLRTLGYDEAKLAPWQRQVILKKGEIPK

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_019585
ORF Size 759 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_019585.3, NP_062531.2
RefSeq Size 1123 bp
RefSeq ORF 762 bp
Locus ID 56226
Cytogenetics 4 82.9 cM
MW 28.5 kDa
Summary Multifunctional actin-bundling protein. Plays a major role in regulating the organization, dimension, dynamics and signaling capacities of the actin filament-rich microvilli in the mechanosensory and chemosensory cells (PubMed:14657236, PubMed:15190118). Required for the assembly and stabilization of the stereociliary parallel actin bundles. Plays a crucial role in the formation and maintenance of inner ear hair cell stereocilia (PubMed:21455486). Involved in the elongation of actin in stereocilia (PubMed:19287378, PubMed:22264607). In extrastriolar hair cells, required for targeting MYO3B to stereocilia tips, and for regulation of stereocilia diameter and staircase formation (PubMed:26926603).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Espn (NM_019585) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC210031 Espn (untagged) - Mouse espin (Espn), transcript variant 6, (10ug) 10 ug
$300.00
MG224961 Espn (tGFP-tagged) - Mouse espin (Espn) transcript variant 6, (10ug) 10 ug
$530.00
MR224961L3 Lenti ORF clone of Espn (Myc-DDK-tagged) - Mouse espin (Espn), transcript variant 6 10 ug
$630.00
MR224961L4 Lenti ORF clone of Espn (mGFP-tagged) - Mouse espin (Espn), transcript variant 6 10 ug
$630.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.