Crem (NM_001110855) Mouse Tagged ORF Clone

SKU MR224355

Crem (Myc-DDK-tagged) - Mouse cAMP responsive element modulator (Crem), transcript variant 11

Product Data

• Type: Mouse Tagged ORF Clone
• Target Symbol: Crem
• Synonyms: IC; ICER; ICERI
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR224355 representing NM_001110855; Red=Cloning site Blue=ORF Green=Tags(s); ; TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC; GCCGCGATCGCC; ; ATGCAAAAGCCCAACATGGCTGTAACTGGAGATGAAACTGCTGCCACAGGTGACATGCCAACTTACCAGA; TCCGAGCTCCTACTACTGCTTTGCCACAAGGTGTGGTGATGGCTGCCTCACCAGGAAGCCTGCACAGTCC; CCAGCAACTAGCAGAAGAAGCAACTCGCAAGCGGGAGCTGAGGCTGATGAAAAACAGGGAAGCTGCCCGG; GAGTGTCGCAGGAAGAAGAAAGAATATGTCAAATGTCTTGAAAATCGTGTGGCTGTGCTTGAAAATCAAA; ACAAGACCCTCATTGAGGAACTCAAGGCCCTCAAAGACCTTTATTGCCATAAAGCAGAG; ; ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT; ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR224355 representing NM_001110855; Red=Cloning site Green=Tags(s); ; MQKPNMAVTGDETAATGDMPTYQIRAPTTALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAR; ECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKAE; ; myc-FLAG tag
• Chromatograms: Chromatograms ; Sequencher program is needed, download here
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001110855
• ORF Size: 339 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.; ; The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution Method: 1. Centrifuge at 5,000xg for 5min.; 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.; 3. Close the tube and incubate for 10 minutes at room temperature.; 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.; 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
• Note: Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required.
• Shipping: Ambient

Reference Data

• RefSeq: NM_001110855.1, NP_001104325.2
• RefSeq Size: 2010 bp
• RefSeq ORF: 342 bp
• Locus ID: 12916
• UniProt ID: P27699
• Cytogenetics: 18 A1
• MW: 13.2 kDa
• Summary: This gene encodes a basic-leucine zipper domain-containing protein that localizes to gene promoters, where it binds to the cyclic AMP response element (CRE). Different protein isoforms encoded by this gene may function as either activators or repressors of transcription. Activity of this gene is important in multiple developmental processes, including spermatogenesis. Mutation of this gene causes male infertility. Alternative splicing and promoter usage result in multiple transcript variants for this gene. [provided by RefSeq, Oct 2012]