Bhlha15 (NM_010800) Mouse Tagged ORF Clone

SKU
MR224224
Bhlha15 (Myc-DDK-tagged) - Mouse basic helix-loop-helix family, member a15 (Bhlha15)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Bhlha15
Synonyms 1810009C13Rik; Bhlhb8; MIST-1; Mist1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR224224 representing NM_010800
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGACCAAAAACCGGCCCCCTCGGCGCCGAACACCCATGCAGGACACAGAAGCCACCCCAGGAGAGC
AGACACCTGACAGACCCCAGTCAGGCTCAGGGGGGTCAGAGCTGACAAAGGGTCTCCGGAGCAGGACAGC
GCGTGCAAGCGGAGGTCGGGGAGAGGTCAGCCGCCGGCGACAGGGGTCTGGTGGCCGCAGGGAGAACAGT
GTTCAGAGGCGGCTGGAGAGCAATGAGCGAGAGAGGCAGCGGATGCATAAACTCAACAATGCCTTCCAGG
CACTGCGCGAGGTCATCCCGCACGTGCGGGCTGACAAGAAGCTCTCCAAGATCGAGACCCTCACGCTGGC
CAAGAACTATATCAAGTCGCTGACCGCCACCATACTTACTATGTCCAGCAGCCGCCTCCCGGGGCTGGAG
GCACCAGGTCCTGCGCCAGGCCCTAAATTATACCAGCACTACCATCACCAGCAGCAGCAACAGCAGCAGC
AGCAGCAGGTAGCTGGGGCCATGCTTGGTGTCACTGAGGACCAGCCCCAAGGCCACCTGCAACGCTACTC
TACACAGATCCACAGCTTCAGAGAGGGGAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR224224 representing NM_010800
Red=Cloning site Green=Tags(s)

MKTKNRPPRRRTPMQDTEATPGEQTPDRPQSGSGGSELTKGLRSRTARASGGRGEVSRRRQGSGGRRENS
VQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATILTMSSSRLPGLE
APGPAPGPKLYQHYHHQQQQQQQQQQVAGAMLGVTEDQPQGHLQRYSTQIHSFREGS

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_010800
ORF Size 591 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_010800.4, NP_034930.1
RefSeq Size 3494 bp
RefSeq ORF 594 bp
Locus ID 17341
UniProt ID Q9QYC3
Cytogenetics 5 G2
MW 22.6 kDa
Summary Plays a role in controlling the transcriptional activity of MyoD, ensuring that expanding myoblast populations remain undifferentiated (PubMed:17612490). Repression may occur through muscle-specific E-box occupancy by homodimers. May also negatively regulate bHLH-mediated transcription through an N-terminal repressor domain. Serves as a key regulator of acinar cell function, stability, and identity. Also required for normal organelle localization in exocrine cells and for mitochondrial calcium ion transport. May function as a unique regulator of gene expression in several different embryonic and postnatal cell lineages. Binds to the E-box consensus sequence 5'-CANNTG-3'.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Bhlha15 (NM_010800) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC208962 Bhlha15 (untagged) - Mouse basic helix-loop-helix family, member a15 (Bhlha15), (10ug) 10 ug
$300.00
MG224224 Bhlha15 (tGFP-tagged) - Mouse basic helix-loop-helix family member a15 (Bhlha15), (10ug) 10 ug
$500.00
MR224224L3 Lenti ORF clone of Bhlha15 (Myc-DDK-tagged) - Mouse basic helix-loop-helix family, member a15 (Bhlha15) 10 ug
$600.00
MR224224L4 Lenti ORF clone of Bhlha15 (mGFP-tagged) - Mouse basic helix-loop-helix family, member a15 (Bhlha15) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.