Cd244 (NM_018729) Mouse Tagged ORF Clone

SKU
MR222873
Cd244 (Myc-DDK-tagged) - Mouse CD244 natural killer cell receptor 2B4 (Cd244)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cd244
Synonyms 2B4; C9.1; F730046O15Rik; Ly90; NAIL; NKR2B4; Nmrk; SLAMF4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR222873 representing NM_018729
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGGGGCAAGCTGTCCTGTTCACAACCTTTCTGCTCCTCAGGGCTCATCAGGGCCAAGACTGCCCAG
ATTCTTCTGAAGAAGTGGTTGGTGTCTCAGGAAAGCCTGTCCAGCTGAGGCCTTCCAACATACAGACAAA
AGATGTTTCTGTTCAATGGAAGAAGACAGAACAGGGCTCACACAGAAAAATTGAGATCCTGAATTGGTAT
AATGATGGTCCCAGTTGGTCAAATGTATCTTTTAGTGATATCTATGGTTTTGATTATGGGGATTTTGCTC
TTAGTATCAAGTCAGCTAAGCTGCAAGACAGTGGTCACTACCTGCTGGAGATCACCAACACAGGCGGAAA
AGTGTGCAATAAGAACTTCCAGCTTCTTATACTTGATCATGTTGAGACCCCTAACCTGAAGGCCCAGTGG
AAGCCCTGGACTAATGGGACTTGTCAACTGTTTTTGTCCTGCTTGGTGACCAAGGATGACAATGTGAGCT
ACGCTTTGTACAGAGGGAGCACTCTGATCTCCAATCAAAGGAATAGTACCCACTGGGAGAACCAGATTGA
CGCCAGCAGCCTGCACACATACACCTGCAACGTTAGCAACAGAGCCAGCTGGGCAAACCACACCCTGAAC
TTCACCCATGGCTGTCAAAGTGTCCCTTCGAATTTCAGATTTCTGCCCTTTGGGGTGATCATCGTGATTC
TAGTTACATTATTTCTCGGGGCCATCATTTGTTTCTGTGTGTGGACTAAGAAGAGGAAGCAGTTACAGTT
CAGCCCTAAGGAACCTTTGACAATATATGAATATGTCAAGGACTCACGAGCCAGCAGGGATCAACAAGGA
TGCTCTAGGGCCTCTGGATCTCCCTCGGCTGTCCAGGAAGATGGGAGGGGACAAAGAGAATTGGACAGGC
GTGTTTCTGAGGTGCTGGAGCAGTTGCCACAGCAGACTTTCCCTGGAGATAGAGGCACCATGTACTCTAT
GATACAGTGCAAGCCTTCTGATTCCACATCACAAGAAAAATGTACAGTATATTCAGTAGTCCAGCCTTCC
AGGAAGTCTGGATCCAAGAAGAGGAACCAGAACTCTTCCTTAAGTTGTACCGTGTACGAGGAGGTTGGAA
ACCCATGGCTCAAAGCTCACAACCCTGCCAGGCTGAGCCGCAGAGAGCTGGAGAACTTTGATGTCTACTC
C


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR222873 representing NM_018729
Red=Cloning site Green=Tags(s)

MLGQAVLFTTFLLLRAHQGQDCPDSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWY
NDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILDHVETPNLKAQW
KPWTNGTCQLFLSCLVTKDDNVSYALYRGSTLISNQRNSTHWENQIDASSLHTYTCNVSNRASWANHTLN
FTHGCQSVPSNFRFLPFGVIIVILVTLFLGAIICFCVWTKKRKQLQFSPKEPLTIYEYVKDSRASRDQQG
CSRASGSPSAVQEDGRGQRELDRRVSEVLEQLPQQTFPGDRGTMYSMIQCKPSDSTSQEKCTVYSVVQPS
RKSGSKKRNQNSSLSCTVYEEVGNPWLKAHNPARLSRRELENFDVYS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018729
ORF Size 1191 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018729.2, NP_061199.2
RefSeq Size 3758 bp
RefSeq ORF 1194 bp
Locus ID 18106
UniProt ID Q07763
Cytogenetics 1 79.52 cM
MW 45.3 kDa
Summary Heterophilic receptor of the signaling lymphocytic activation molecule (SLAM) family; its ligand is CD48. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Acts as activating natural killer (NK) cell receptor (PubMed:8326140, PubMed:12734329, PubMed:19648922, PubMed:20962259). Activating function implicates association with SH2D1A and FYN. Downstreaming signaling involves predominantly VAV1, and, to a lesser degree, INPP5D/SHIP1 and CBL. Signal attenuation in the absence of SH2D1A is proposed to be dependent on INPP5D and to a lesser extent PTPN6/SHP-1 and PTPN11/SHP-2. Stimulates NK cell cytotoxicity, production of IFN-gamma and granule exocytosis (PubMed:8326140, PubMed:15169881, PubMed:15998796, PubMed:22683124). Optimal expansion and activation of NK cells seems to be dependent on the engagement of CD244 with CD48 expressed on neighboring NK cells (PubMed:15905190). Regulation of NK cell activity by adapters Sh2d1b and Sh2d1b2 is reported conflictingly (PubMed:16127454, PubMed:16425036). Acts as costimulator in NK activation by enhancing signals by other NK receptors such as NCR3 and NCR1. At early stages of NK cell differentiation may function as an inhibitory receptor possibly ensuring the self-tolerance of developing NK cells (By similarity). Involved in the regulation of CD8(+) T-cell proliferation; expression on activated T-cells and binding to CD488 provides costimulatory-like function for neighboring T-cells (PubMed:11739483). Inhibits inflammatory responses in dendritic cells (DCs) (PubMed:25643613).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Cd244 (NM_018729) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC209044 Cd244 (untagged) - Mouse CD244 natural killer cell receptor 2B4 (Cd244), (10ug) 10 ug
$686.00
MG222873 Cd244 (tGFP-tagged) - Mouse CD244 natural killer cell receptor 2B4 (Cd244), (10ug) 10 ug
$886.00
MR222873L1 Lenti ORF clone of Cd244 (Myc-DDK-tagged) - Mouse CD244 natural killer cell receptor 2B4 (Cd244) 10 ug
$986.00
MR222873L2 Lenti ORF clone of Cd244 (mGFP-tagged) - Mouse CD244 natural killer cell receptor 2B4 (Cd244) 10 ug
$986.00
MR222873L3 Lenti ORF clone of Cd244 (Myc-DDK-tagged) - Mouse CD244 natural killer cell receptor 2B4 (Cd244) 10 ug
$986.00
MR222873L4 Lenti ORF clone of Cd244 (mGFP-tagged) - Mouse CD244 natural killer cell receptor 2B4 (Cd244) 10 ug
$986.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.