C1qtnf5 (NM_001040632) Mouse Tagged ORF Clone

SKU
MR221727
C1qtnf5 (Myc-DDK-tagged) - Mouse C1q and tumor necrosis factor related protein 5 (C1qtnf5), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol C1qtnf5
Synonyms Adie; CTR; Ctrp5; Mfrp
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR221727 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGCCACTTCTTGCCCTTCTGCTTCTGGGTCTGGTGTCAGGCTCTCCTCCTCTGGACGACAACAAGA
TCCCCAGCCTGTGTCCCGGGCAGCCCGGCCTTCCAGGCACACCAGGTCACCATGGCAGCCAAGGCCTGCC
TGGCCGTGACGGCCGTGATGGCCGCGACGGTGCACCCGGAGCCCCGGGAGAGAAAGGCGAGGGCGGGAGA
CCGGGACTACCTGGGCCACGTGGGGAGCCCGGGCCGCGTGGAGAGGCAGGGCCCATGGGGGCTATCGGGC
CTGCGGGGGAGTGCTCGGTACCCCCACGATCAGCCTTCAGTGCCAAGCGATCCGAGAGCCGGGTACCTCC
GCCAGCCGACACACCCCTACCTTTCGACCGTGTGCTGCTAAATGAGCAGGGCCATTTCGACCCCACTACT
GGCAAGTTCACCTGCCAAGTGCCTGGCGTCTACTACTTTGCTGTGCACGCCACTGTCTACCGGGCCAGCT
TGCAGTTTGATCTTGTCAAAAACGGGCAGTCCATCGCCTCTTTCTTCCAGTATTTTGGGGGGTGGCCCAA
GCCAGCCTCGCTCTCAGGGGGTGCGATGGTAAGGCTAGAACCTGAGGACCAGGTGTGGGTGCAGGTGGGC
GTGGGTGATTACATTGGCATCTATGCCAGCATCAAGACAGACAGTACCTTCTCTGGATTTCTCGTCTATT
CTGACTGGCACAGCTCCCCAGTCTTCGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR221727 protein sequence
Red=Cloning site Green=Tags(s)

MRPLLALLLLGLVSGSPPLDDNKIPSLCPGQPGLPGTPGHHGSQGLPGRDGRDGRDGAPGAPGEKGEGGR
PGLPGPRGEPGPRGEAGPMGAIGPAGECSVPPRSAFSAKRSESRVPPPADTPLPFDRVLLNEQGHFDPTT
GKFTCQVPGVYYFAVHATVYRASLQFDLVKNGQSIASFFQYFGGWPKPASLSGGAMVRLEPEDQVWVQVG
VGDYIGIYASIKTDSTFSGFLVYSDWHSSPVFA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001040632
ORF Size 729 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001040632.1, NM_001040632.2, NP_001035722.1
RefSeq Size 1366 bp
RefSeq ORF 732 bp
Locus ID 235312
UniProt ID Q8K479
Cytogenetics 9 24.62 cM
MW 25.4 kDa
Summary The protein encoded by this gene is a member of the C1q/tumor necrosis factor superfamily. This family member is a secretory protein that functions in eye development. Mutations in this gene are thought to underlie the pathophysiology of late-onset retinal degeneration (L-ORD) and early-onset long anterior zonules (LAZ). Bicistronic transcripts composed of the coding sequences for this gene (C1qtnf5) and the membrane-type frizzled-related protein gene (Mfrp) have been identified, and the resulting products can interact with each other. Co-transcription of C1qtnf5 and Mfrp has been observed in both human and mouse. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2010]
Write Your Own Review
You're reviewing:C1qtnf5 (NM_001040632) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC202206 C1qtnf5 (untagged) - Mouse C1q and tumor necrosis factor related protein 5 (C1qtnf5), transcript variant 2, (10ug) 10 ug
$300.00
MG203025 C1qtnf5 (tGFP-tagged) - Mouse C1q and tumor necrosis factor related protein 5 (C1qtnf5), transcript variant 2 10 ug
$500.00
MG221727 C1qtnf5 (tGFP-tagged) - Mouse C1q and tumor necrosis factor related protein 5 (C1qtnf5) transcript variant 2, (10ug) 10 ug
$500.00
MR221727L3 Lenti ORF clone of C1qtnf5 (Myc-DDK-tagged) - Mouse C1q and tumor necrosis factor related protein 5 (C1qtnf5), transcript variant 2 10 ug
$600.00
MR221727L4 Lenti ORF clone of C1qtnf5 (mGFP-tagged) - Mouse C1q and tumor necrosis factor related protein 5 (C1qtnf5), transcript variant 2 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.