Fut2 (NM_018876) Mouse Tagged ORF Clone

SKU
MR219943
Fut2 (Myc-DDK-tagged) - Mouse fucosyltransferase 2 (Fut2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Fut2
Synonyms MFUT-II
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR219943 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGAGTGCCCAGGTACCTTTCTCCTTTCCTCTGGCCCACTTCCTCATCTTTGTCTTTGTGACTTCCA
CCATCATCCACCTCCAGCAACGAATAGTGAAGCTCCAAACCCTGTCAGAGAAGGAATTACAGGCGGTTCA
AATGTCCTCACCAAACGCGGCAAGAACAGACATGCAGCAGAGTGCCAAGCTGCAGGGCATATTCACGATC
AATTCCATCGGCCGCCTGGGGAACCAGATGGGCGAATATGCTACATTGTTTGCACTGGCCAGGATGAACG
GTCGGCTTGCCTTCATCCCTGAATCCATGCACAACGCTCTAGCGCCCATCTTCAGGATCAGTCTCCCGGT
GTTACACAGCGACACAGCCAGAAGGATCCCGTGGCAGAATTACCACCTCAACGACTGGATGGAGGAGCGT
TACCGCCACATCCCGGGGCAGTATGTGCGTTTCACGGGATACCCGTGCTCCTGGACCTTCTACCACCACC
TGCGCCCAGAGATCCTGAAGGAGTTCACCCTGCACGACCATGTGCGTGAGGAGGCCCAGGCTTTCCTGCG
TGGCCTGCGGGTGAATGGGAGCCAGCCGAGTACCTTTGTGGGTGTCCATGTGCGCCGAGGGGACTATGTG
CATGTCATGCCCAAGGTGTGGAAGGGCGTGGTGGCTGACCGGGGTTACCTAGAAAAGGCCCTGGACAGGT
TCCGGGCACGCTATTCATCTCCAGTCTTCGTGGTTACAAGCAACGGTATGGCCTGGTGCCGGGAGAACAT
CAACACCTCCCTAGGAGACGTGGTGTTTGCGGGCAATGGTATTGAGGGCTCACCAGCCAAGGACTTCGCG
CTCCTCACCCAGTGCAACCACACCATCATGACCATTGGAACCTTTGGGATTTGGGCTGCCTACCTGGCAG
GTGGTGATACCATCTACCTAGCCAACTACACCCTTCCGGATTCTCCGTTCCTCAAAATCTTTAAGCCAGC
AGCAGCCTTCCTCCCCGAGTGGATGGGCATCCCCGCAGACCTGTCCCCACTCCTTAAGCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR219943 protein sequence
Red=Cloning site Green=Tags(s)

MASAQVPFSFPLAHFLIFVFVTSTIIHLQQRIVKLQTLSEKELQAVQMSSPNAARTDMQQSAKLQGIFTI
NSIGRLGNQMGEYATLFALARMNGRLAFIPESMHNALAPIFRISLPVLHSDTARRIPWQNYHLNDWMEER
YRHIPGQYVRFTGYPCSWTFYHHLRPEILKEFTLHDHVREEAQAFLRGLRVNGSQPSTFVGVHVRRGDYV
HVMPKVWKGVVADRGYLEKALDRFRARYSSPVFVVTSNGMAWCRENINTSLGDVVFAGNGIEGSPAKDFA
LLTQCNHTIMTIGTFGIWAAYLAGGDTIYLANYTLPDSPFLKIFKPAAAFLPEWMGIPADLSPLLKH

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018876
ORF Size 1041 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018876.4, NP_061364.2
RefSeq Size 2969 bp
RefSeq ORF 1044 bp
Locus ID 14344
UniProt ID Q9JL27
Cytogenetics 7 29.41 cM
MW 39.2 kDa
Summary This gene is one of three genes in mouse which encode a galactoside 2-L-fucosyltransferase. These genes differ in their developmental- and tissue-specific expression. The encoded type II membrane protein is anchored in the Golgi apparatus and controls the final step in the creation of alpha (1,2) fucosylated carbhohydrates by the addition of a terminal fucose in an alpha (1,2) linkage. This enzyme is involved in the synthesis of the Lewis antigen as well as the H-antigen, a precursor of the A and B antigens of the ABH histo-blood group. The biological function of the fucosylated carbhohydrate products is thought to involve cell-adhesion and interactions with microorganisms. Disruption of this gene results in altered glycosylation of gastric mucosa and uterine epithelia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2012]
Write Your Own Review
You're reviewing:Fut2 (NM_018876) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC208513 Fut2 (untagged) - Mouse fucosyltransferase 2 (Fut2), (10ug) 10 ug
$732.00
MG219943 Fut2 (tGFP-tagged) - Mouse fucosyltransferase 2 (Fut2), (10ug) 10 ug
$886.00
MR219943L3 Lenti ORF clone of Fut2 (Myc-DDK-tagged) - Mouse fucosyltransferase 2 (Fut2) 10 ug
$986.00
MR219943L4 Lenti ORF clone of Fut2 (mGFP-tagged) - Mouse fucosyltransferase 2 (Fut2) 10 ug
$986.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.