Capns2 (NM_027112) Mouse Tagged ORF Clone

SKU
MR219341
Capns2 (Myc-DDK-tagged) - Mouse calpain, small subunit 2 (Capns2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Capns2
Synonyms 30K-2; 2310005G05Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR219341 representing NM_027112
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTCTCGCAAAGGCGATCCTGGAAGGTGCAGATCGGGGGCTTGGAGGGGCTCTTGGAGGCCTTCTTG
GAGGAGGTGGTCAGGCAAGAGCAGGCGGGGGCAACATCGGGGGAATCCTTGGAGGAATTGTCAATTTTAT
CAGCGAGGCTGCCGCAGCTCAGTACACCCCAGAGCCGCCTCCCCAACAGCAGCATTTTACCGTCGTGGAG
GCCTCAGAAAGTGAGGAAGTCAGACGTTTTCGGCAGCAATTTACACAGCTGGCTGGACCCGACATGGAGG
TGGGTGCTACTGACCTGATGAATATTCTCAACAAAGTCCTTTCTAAGCATAAAGAGCTGAAGACAGAGGG
CTTCAGCCTTGATACCTGTAGGAGCATTGTGTCTGTCATGGACAGTGACACCACAGGGAAACTGGGATTT
GAGGAATTTAAGTACCTGTGGAACAACATCAAGAAATGGCAGTGTGTTTTCAAGCAGTACGACAGTGACC
ATTCTGGCTCCCTCGGAAGCTCCCAGCTGCACGGGGCCATGCAGGCAGCGGGCTTCCAGCTCAATGAGCA
ACTTTACCTAATGATTGTCCGTCGGTATGCTGACGAAGATGGCGGGATGGATTTTAACAACTTTATCAGC
TGCCTGGTTCGCCTGGATGCTATGTTTCGAGCTTTCAAGGCTCTGGACCGAGATAGGGATGGCCTGATTC
AGGTGTCCATCCGAGAATGGCTGCAGCTGACCATGTATTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR219341 representing NM_027112
Red=Cloning site Green=Tags(s)

MFLAKAILEGADRGLGGALGGLLGGGGQARAGGGNIGGILGGIVNFISEAAAAQYTPEPPPQQQHFTVVE
ASESEEVRRFRQQFTQLAGPDMEVGATDLMNILNKVLSKHKELKTEGFSLDTCRSIVSVMDSDTTGKLGF
EEFKYLWNNIKKWQCVFKQYDSDHSGSLGSSQLHGAMQAAGFQLNEQLYLMIVRRYADEDGGMDFNNFIS
CLVRLDAMFRAFKALDRDRDGLIQVSIREWLQLTMYS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_027112
ORF Size 741 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_027112.1, NP_081388.1
RefSeq Size 1015 bp
RefSeq ORF 744 bp
Locus ID 69543
UniProt ID Q9D7J7
Cytogenetics 8 C5
MW 27.6 kDa
Summary Calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. This small subunit may act as a tissue-specific chaperone of the large subunit, possibly by helping it fold into its correct conformation for activity (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Capns2 (NM_027112) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC210957 Capns2 (untagged) - Mouse calpain, small subunit 2 (Capns2), (10ug) 10 ug
$480.00
MG219341 Capns2 (tGFP-tagged) - Mouse calpain small subunit 2 (Capns2), (10ug) 10 ug
$650.00
MR219341L3 Lenti ORF clone of Capns2 (Myc-DDK-tagged) - Mouse calpain, small subunit 2 (Capns2) 10 ug
$750.00
MR219341L4 Lenti ORF clone of Capns2 (mGFP-tagged) - Mouse calpain, small subunit 2 (Capns2) 10 ug
$750.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.