Zswim7 (NM_027198) Mouse Tagged ORF Clone

SKU
MR218852
Zswim7 (Myc-DDK-tagged) - Mouse zinc finger, SWIM-type containing 7 (Zswim7)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Zswim7
Synonyms 2410012H22Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR218852 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGTCGCGCTCCCGGAGGTGGTGGAAGAGCTCCTGAGCGAGATGGCCGCCGCTGTGCGAGACAGCG
CGAGAATTCCCGACGAGCTTCTCTTATCGCTGGAGTTTGTGTTTGGGTCATCGGCCATCCAGGCCTTGGA
CCTAGTCGATCGAGAGTCCGTCACTTTAATCTCATCACCCAGTGGAAGGCGTGTTTACCAGGTGCTAGGG
AGTTCTGGCAAAACATATACATGTCTGGCTTCCTGTCATTACTGCTCGTGCCCAGCATTCTCCTTCTCAG
TGTTACGGAAGAGTGACAGCCTGCTGTGTAAGCATCTTCTGGCAATTTACCTTAGTCAGCTTCTGAGGAA
CTGCCAGCAGCTCCATGTGTCTGACAAGCAACTGACAGACCTATTGATGGAGGACACAAGAAGGATAAAA
GGTGCGGCTGGAACATGGACTTCAAAGACAGAAGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR218852 protein sequence
Red=Cloning site Green=Tags(s)

MAVALPEVVEELLSEMAAAVRDSARIPDELLLSLEFVFGSSAIQALDLVDRESVTLISSPSGRRVYQVLG
SSGKTYTCLASCHYCSCPAFSFSVLRKSDSLLCKHLLAIYLSQLLRNCQQLHVSDKQLTDLLMEDTRRIK
GAAGTWTSKTEA

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_027198
ORF Size 456 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_027198.1, NP_081474.1
RefSeq Size 776 bp
RefSeq ORF 459 bp
Locus ID 69747
UniProt ID Q9CWQ2
Cytogenetics 11 B2
MW 16.7 kDa
Summary Involved in early stages of the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Zswim7 (NM_027198) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC210997 Zswim7 (untagged) - Mouse zinc finger, SWIM-type containing 7 (Zswim7), (10ug) 10 ug
$165.00
MG218852 Zswim7 (tGFP-tagged) - Mouse zinc finger SWIM-type containing 7 (Zswim7), (10ug) 10 ug
$350.00
MR218852L3 Lenti ORF clone of Zswim7 (Myc-DDK-tagged) - Mouse zinc finger, SWIM-type containing 7 (Zswim7) 10 ug
$450.00
MR218852L4 Lenti ORF clone of Zswim7 (mGFP-tagged) - Mouse zinc finger, SWIM-type containing 7 (Zswim7) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.