Lcn5 (NM_007947) Mouse Tagged ORF Clone

SKU
MR218156
Lcn5 (Myc-DDK-tagged) - Mouse lipocalin 5 (Lcn5), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Lcn5
Synonyms E-RABP; Er; Erabp; mE-R; MEP1; MEP10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR218156 representing NM_007947
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGCTCAGTTGCTAGGCATATGGAGAGCATCATGCTCTTCACCTTGCTGGGACTGTGTGTGGGGCTGG
CAGCTGGCACAGAGGCTGCAGTGGTGAAGGACTTCGACGTAAACAAGTTTTTAGGCTTCTGGTATGAAAT
TGCCCTTGCCTCCAAGATGGGTGCATACGGCTTGGCACACAAGGAGGAGAAGATGGGAGCCATGGTGGTT
GAGCTGAAAGAGAACCTTCTGGCTCTGACCACCACCTATTACAATGAGGGCCACTGTGTGCTGGAGAAGG
TTGCAGCCACTCAGGTGGACGGTTCAGCGAAGTACAAGGTCACCAGAATATCAGGAGAGAAAGAAGTTGT
TGTTGTAGCCACAGACTACATGACGTATACTGTGATTGATATCACCTCTCTGGTGGCCGGGGCAGTACAT
CGAGCCATGAAACTGTACAGCCGGAGCTTGGACAACAATGGGGAAGCTCTGAATAATTTCCAGAAGATAG
CCTTGAAGCATGGGTTTTCAGAAACAGACATACACATTCTCAAGCATGACTTAACCTGTGTGAACGCATT
GCAATCGGGACAGATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR218156 representing NM_007947
Red=Cloning site Green=Tags(s)

MCSVARHMESIMLFTLLGLCVGLAAGTEAAVVKDFDVNKFLGFWYEIALASKMGAYGLAHKEEKMGAMVV
ELKENLLALTTTYYNEGHCVLEKVAATQVDGSAKYKVTRISGEKEVVVVATDYMTYTVIDITSLVAGAVH
RAMKLYSRSLDNNGEALNNFQKIALKHGFSETDIHILKHDLTCVNALQSGQI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007947
ORF Size 576 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007947.3, NP_031973.2
RefSeq Size 695 bp
RefSeq ORF 579 bp
Locus ID 13863
UniProt ID A2AJB7
Cytogenetics 2 A3
MW 21.5 kDa
Summary This gene encodes a small secreted protein that is expressed in the epididymis and binds retinoic acid. The precursor protein is processed into both a longer major form and a shorter minor form. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2013]
Write Your Own Review
You're reviewing:Lcn5 (NM_007947) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC208447 Lcn5 (untagged) - Mouse lipocalin 5 (Lcn5), transcript variant 1, (10ug) 10 ug
$330.00
MG218156 Lcn5 (tGFP-tagged) - Mouse lipocalin 5 (Lcn5) transcript variant 1, (10ug) 10 ug
$500.00
MR218156L3 Lenti ORF clone of Lcn5 (Myc-DDK-tagged) - Mouse lipocalin 5 (Lcn5), transcript variant 1 10 ug
$600.00
MR218156L4 Lenti ORF clone of Lcn5 (mGFP-tagged) - Mouse lipocalin 5 (Lcn5), transcript variant 1 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.