Acer1 (NM_175731) Mouse Tagged ORF Clone

SKU
MR217552
Acer1 (Myc-DDK-tagged) - Mouse alkaline ceramidase 1 (Acer1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Acer1
Synonyms 2310024P18Rik; AI662009; Alkcdase1; Asah3; Cer1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR217552 representing NM_175731
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCATGTACCGGGCACCAGAGCAAAGATGTCCAGCATCTTTGCCTATCAGAGTTCTGAGGTGGATTGGT
GTGAGAGTAATTTCCAGCACTCAGAGTTGGTGGCCGAGTTCTACAATACGTTCAGCAATGTGTTCTTCCT
CATCTTTGGACCCCTCATGATGTTCCTCATGCATCCGTATGCCCAGAAGCGTACCCGGTGTTTCTATGGA
GTGTCAGTCCTCTTCATGCTCATAGGTCTGTTCTCCATGTATTTCCACATGACACTCAGCTTTCTGGGAC
AGCTGCTGGATGAGATCTCCATCCTGTGGTTGTTGGCCAGTGGATACAGTGTGTGGCTGCCCCGTTGCTA
TTTTCCCAAGTTCGTCAAGGGGAACAGGTTCTACTTCAGCTGCCTGGTAACTATAACCACTATTATCAGC
ACCTTCTTGACGTTCGTGAAGCCCACAGTCAATGCATATGCTCTCAACAGCATCGCCATCCACATCCTCT
ACATTGTGCGCACAGAGTACAAGAAGATTAGGGATGATGATCTTCGGCATCTGATTGCGGTTTCTGTGGT
CTTATGGGCCGCTGCACTGACCAGCTGGATCAGTGACCGTGTACTTTGCAGCTTCTGGCAGCGGATTCAC
TTCTACTACCTGCACAGCATTTGGCACGTCCTCATAAGCATCACATTTCCTTATGGTATCGTGACCATGG
CCCTGGTGGATGCAAAGTATGAGATGCCAGATAAAACCCTCAAAGTCCACTACTGGCCCCGGGACAGCTG
GGTCATCGGGCTACCCTATGTGGAGATCCAGGAGAATGACAAGAACTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR217552 representing NM_175731
Red=Cloning site Green=Tags(s)

MHVPGTRAKMSSIFAYQSSEVDWCESNFQHSELVAEFYNTFSNVFFLIFGPLMMFLMHPYAQKRTRCFYG
VSVLFMLIGLFSMYFHMTLSFLGQLLDEISILWLLASGYSVWLPRCYFPKFVKGNRFYFSCLVTITTIIS
TFLTFVKPTVNAYALNSIAIHILYIVRTEYKKIRDDDLRHLIAVSVVLWAAALTSWISDRVLCSFWQRIH
FYYLHSIWHVLISITFPYGIVTMALVDAKYEMPDKTLKVHYWPRDSWVIGLPYVEIQENDKNC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_175731
ORF Size 819 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_175731.4, NP_783858.1
RefSeq Size 2429 bp
RefSeq ORF 822 bp
Locus ID 171168
UniProt ID Q8R4X1
Cytogenetics 17 D
MW 32.5 kDa
Summary Endoplasmic reticulum ceramidase that catalyzes the hydrolysis of ceramides into sphingosine and free fatty acids at alkaline pH (PubMed:12783875). Ceramides, sphingosine, and its phosphorylated form sphingosine-1-phosphate are bioactive lipids that mediate cellular signaling pathways regulating several biological processes including cell proliferation, apoptosis and differentiation (PubMed:12783875). Exhibits a strong substrate specificity towards the natural stereoisomer of ceramides with D-erythro-sphingosine as a backbone and has a higher activity towards very long-chain unsaturated fatty acids like the C24:1-ceramide (PubMed:12783875). May also hydrolyze dihydroceramides to produce dihydrosphingosine (By similarity). ACER1 is a skin-specific ceramidase that regulates the levels of ceramides, sphingosine and sphingosine-1-phosphate in the epidermis, mediates the calcium-induced differentiation of epidermal keratinocytes and more generally plays an important role in skin homeostasis (PubMed:27126290, PubMed:29056331).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Acer1 (NM_175731) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC212348 Acer1 (untagged) - Mouse alkaline ceramidase 1 (Acer1), (10ug) 10 ug
$330.00
MG217552 Acer1 (tGFP-tagged) - Mouse alkaline ceramidase 1 (Acer1), (10ug) 10 ug
$500.00
MR217552L3 Lenti ORF clone of Acer1 (Myc-DDK-tagged) - Mouse alkaline ceramidase 1 (Acer1) 10 ug
$600.00
MR217552L4 Lenti ORF clone of Acer1 (mGFP-tagged) - Mouse alkaline ceramidase 1 (Acer1) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.