Mrfap1 (NM_026242) Mouse Tagged ORF Clone

SKU
MR216810
Mrfap1 (Myc-DDK-tagged) - Mouse Morf4 family associated protein 1 (Mrfap1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
4 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Mrfap1
Synonyms 9130413I22Rik; AL022827; Pam14
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR216810 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGCCCCTGGACGCGGTGGAGCTGGCGGAGCCCGAGGAGGTGGAGGTGCTGGAGCCCGAGGAGGACT
TCGAGCAGTTTCTGCTGCCCGTCATCCACGAGATGCGCGAGGACATCGCGTCGCTGACGCGCGAGCGCGG
GCGCGCGCCGGCGCGCAACCGGGGCAAGCTGTGGGAGATGGACAATATGCTGATCCAGATCAAGACGCAG
GTCGAGGCCTCCGAGGAGAGCGCCCTCAACCACCTGCAGGGTGCCGGCGGCGCCGAGCCCCGCGGCCCCC
GGGCGGAGAAGGCCGACGAGAAGGCGCAGGAGATGGCGAAGATGGCCGAGATGCTGGTGCAGCTCGTGCG
GCGGATAGAGAAGAGCGAGTCTTCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR216810 protein sequence
Red=Cloning site Green=Tags(s)

MRPLDAVELAEPEEVEVLEPEEDFEQFLLPVIHEMREDIASLTRERGRAPARNRGKLWEMDNMLIQIKTQ
VEASEESALNHLQGAGGAEPRGPRAEKADEKAQEMAKMAEMLVQLVRRIEKSESS

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_026242
ORF Size 375 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026242.3, NP_080518.1
RefSeq Size 1630 bp
RefSeq ORF 378 bp
Locus ID 67568
UniProt ID Q9CQL7
Cytogenetics 5 B3
MW 14.2 kDa
Write Your Own Review
You're reviewing:Mrfap1 (NM_026242) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC210572 Mrfap1 (untagged) - Mouse Morf4 family associated protein 1 (Mrfap1), (10ug) 10 ug
$165.00
MG216810 Mrfap1 (tGFP-tagged) - Mouse Morf4 family associated protein 1 (Mrfap1), (10ug) 10 ug
$350.00
MR216810L3 Lenti ORF clone of Mrfap1 (Myc-DDK-tagged) - Mouse Morf4 family associated protein 1 (Mrfap1) 10 ug
$450.00
MR216810L4 Lenti ORF clone of Mrfap1 (mGFP-tagged) - Mouse Morf4 family associated protein 1 (Mrfap1) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.