Nme5 (NM_080637) Mouse Tagged ORF Clone

SKU
MR216332
Nme5 (Myc-DDK-tagged) - Mouse non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase) (Nme5)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Nme5
Synonyms 1700019D05Rik; Nm23-M5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR216332 representing NM_080637
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGTATCAATGCCCCTGCCTCAGATATATGTAGAAAAAACCCTAGCCCTTATCAAGCCAGATGTTG
TTGACAAAGAAGAGGAGATACAGGATATTATTCTGGGATCTGGATTCACCATTATTCAGAGACGGAAACT
ACACCTGAGCCCCGAGCACTGTAGTAACTTTTATGTGGAGCAGTATGGGAAAATGTTTTTCCCAAACTTA
ACAGCTTATATGAGCTCTGGACCTCTTGTTGCTATGATATTAGCTAGACATAAGGCCATCTCCTACTGGA
AAGAACTTATGGGACCAAGTAACAGTTTAGTAGCCAAGGAGACACACCCGGACAGCTTAAGGGCGATATA
CGGTACAGACGAGCTCAGGAACGCACTTCATGGGAGCAATGACTTCGCTGCCTCAGAGCGAGAGATCAGG
TTCATGTTTCCAGCCGTGATTATTGAACCCATTCCAATTGGACAAGCCGCTAAGGACTACATAAACTTGT
ACGTAGCGCCAACCCTACTTCAAGGACTCACAGAGCTTTGTAAGGAAAAGCCACCAGACCCTTACCTCTG
GCTCGCTGATTGGCTGATGAAAAATAATCCCAACAAACCTAAACTTTGTCATTTCCCAGTGACAGAAGAG
CCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR216332 representing NM_080637
Red=Cloning site Green=Tags(s)

MEVSMPLPQIYVEKTLALIKPDVVDKEEEIQDIILGSGFTIIQRRKLHLSPEHCSNFYVEQYGKMFFPNL
TAYMSSGPLVAMILARHKAISYWKELMGPSNSLVAKETHPDSLRAIYGTDELRNALHGSNDFAASEREIR
FMFPAVIIEPIPIGQAAKDYINLYVAPTLLQGLTELCKEKPPDPYLWLADWLMKNNPNKPKLCHFPVTEE
P

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_080637
ORF Size 633 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_080637.4
RefSeq Size 829 bp
RefSeq ORF 636 bp
Locus ID 75533
UniProt ID Q99MH5
Cytogenetics 18 B1
MW 24 kDa
Summary Does not seem to have NDK kinase activity. Confers protection from cell death by Bax and alters the cellular levels of several antioxidant enzymes including Gpx5. May play a role in spermiogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Nme5 (NM_080637) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC211653 Nme5 (untagged) - Mouse non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase) (Nme5), (10ug) 10 ug
$330.00
MG216332 Nme5 (tGFP-tagged) - Mouse non-metastatic cells 5 protein expressed in (nucleoside-diphosphate kinase) (Nme5), (10ug) 10 ug
$500.00
MR216332L3 Lenti ORF clone of Nme5 (Myc-DDK-tagged) - Mouse non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase) (Nme5) 10 ug
$600.00
MR216332L4 Lenti ORF clone of Nme5 (mGFP-tagged) - Mouse non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase) (Nme5) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.