Plb1 (NM_172147) Mouse Tagged ORF Clone

SKU
MR215680
Plb1 (Myc-DDK-tagged) - Mouse phospholipase B1 (Plb1), transcript variant 3
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$480.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Plb1
Synonyms 4632413E21Rik; 4930433E17Rik; 4930539A06Rik; BC033606
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR215680 representing NM_172147
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGAGCTGAAGAAACTAAACTGGAACCTCCAGAGCGGCATCTCCGAGCTCTCCTATTGGCACCGGT
ACATGGAGCGTGAGGACTTCGCAGTCACTGTGCAGCCTTTCTTCCGGAATACCTTTATCCCACTGAATGA
GCGTGAGGGCCTGGACCTCACTTTCTTCTCTGAAGACTGTTTCTACTTCTCAGACCGTGGGCATGCTGAG
ATGGCCATTGCCCTCTGGAATAACATGCTGGAACCAGTGGGCTGGAAGACATCCTCCAATAACTTCATAT
ACAACAGAACCAAACTCAAGTGCCCCTCACCTGAAAGGCCTTTCCTCTACACCCTCCGGAATAGTCAGCT
TCTTCCAGACAAGGCTGAAGAACCCTCCAATGCACTCTACTGGGCAGTGCCAGTGGCAGCAATAGGTGGC
CTGGCAGTTGGCATCCTTGGAGTGATGTTGTGGAGAACTGTGAAACCCGTCCAACAGGAGGAGGAGGAGG
AGGACACTCTTCCAAATACAAGTGTGACCCAGGATGCTGTATCAGAAAAGAGGCTCAAAGCTGGGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR215680 representing NM_172147
Red=Cloning site Green=Tags(s)

MQELKKLNWNLQSGISELSYWHRYMEREDFAVTVQPFFRNTFIPLNEREGLDLTFFSEDCFYFSDRGHAE
MAIALWNNMLEPVGWKTSSNNFIYNRTKLKCPSPERPFLYTLRNSQLLPDKAEEPSNALYWAVPVAAIGG
LAVGILGVMLWRTVKPVQQEEEEEDTLPNTSVTQDAVSEKRLKAGN

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_172147
ORF Size 558 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_172147.2, NP_742159.1
RefSeq Size 763 bp
RefSeq ORF 561 bp
Locus ID 665270
Cytogenetics 5 B1
MW 21.9 kDa
Summary Membrane-associated phospholipase. Exhibits a calcium-independent broad substrate specificity including phospholipase A2/lysophospholipase activity. Preferential hydrolysis at the sn-2 position of diacylphospholipids and diacyglycerol, whereas it shows no positional specificity toward triacylglycerol. Exhibits also esterase activity toward p-nitrophenyl. May act on the brush border membrane to facilitate the absorption of digested lipids (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Plb1 (NM_172147) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC215360 Plb1 (untagged) - Mouse phospholipase B1 (Plb1), transcript variant 3, (10ug) 10 ug
$450.00
MG215680 Plb1 (tGFP-tagged) - Mouse phospholipase B1 (Plb1) transcript variant 3, (10ug) 10 ug
$680.00
MR215680L3 Lenti ORF clone of Plb1 (Myc-DDK-tagged) - Mouse phospholipase B1 (Plb1), transcript variant 3 10 ug
$780.00
MR215680L4 Lenti ORF clone of Plb1 (mGFP-tagged) - Mouse phospholipase B1 (Plb1), transcript variant 3 10 ug
$780.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.