Ace2 (NM_001130513) Mouse Tagged ORF Clone

CAT#: MR210755

Reviews ()
Write a review
  • TrueORF®

Ace2 (Myc-DDK-tagged) - Mouse angiotensin I converting enzyme (peptidyl-dipeptidase A) 2 (Ace2), transcript variant 1



  "NM_001130513" in other vectors (3)

Interest in protein/lysate? Submit request here!

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 691.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Ace2
Synonyms 2010305L05Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR210755 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCAGCTCCTCCTGGCTCCTTCTCAGCCTTGTTGCTGTTACTACTGCTCAGTCCCTCACCGAGGAAA
ATGCCAAGACATTTTTAAACAACTTTAATCAGGAAGCTGAAGACCTGTCTTATCAAAGTTCACTTGCTTC
TTGGAATTATAATACTAACATTACTGAAGAAAATGCCCAAAAGATGAGTGAGGCTGCAGCCAAATGGTCT
GCCTTTTATGAAGAACAGTCTAAGACTGCCCAAAGTTTCTCACTACAAGAAATCCAGACTCCGATCATCA
AGCGTCAACTACAGGCCCTTCAGCAAAGTGGGTCTTCAGCACTCTCAGCAGACAAGAACAAACAGTTGAA
CACAATTCTGAACACCATGAGCACCATTTACAGTACTGGAAAAGTTTGCAACCCAAAGAACCCACAAGAA
TGCTTATTACTTGAGCCAGGATTGGATGAAATAATGGCGACAAGCACAGACTACAACTCTAGGCTCTGGG
CATGGGAGGGCTGGAGGGCTGAGGTTGGCAAGCAGCTGAGGCCGTTGTATGAAGAGTATGTGGTCCTGAA
AAACGAGATGGCAAGAGCAAACAATTATAACGACTATGGGGATTATTGGAGAGGGGACTATGAAGCAGAG
GGAGCAGATGGCTACAACTATAACCGTAACCAGTTGATTGAAGATGTAGAACGTACCTTCGCAGAGATCA
AGCCATTGTATGAGCATCTTCATGCCTATGTGAGGAGGAAGTTGATGGATACCTACCCTTCCTACATCAG
CCCCACTGGATGCCTCCCTGCCCATTTGCTTGGTGATATGTGGGGTAGATTTTGGACAAATCTGTACCCT
TTGACTGTTCCCTTTGCACAGAAACCAAACATAGATGTTACTGATGCAATGATGAATCAGGGCTGGGATG
CAGAAAGGATATTTCAAGAGGCAGAGAAATTCTTTGTTTCTGTTGGCCTTCCTCATATGACTCAAGGATT
CTGGGCAAACTCTATGCTGACTGAGCCAGCAGATGGCCGGAAAGTTGTCTGCCACCCCACAGCTTGGGAT
CTGGGACACGGAGACTTCAGAATCAAGATGTGTACAAAGGTCACAATGGACAACTTCTTGACAGCCCATC
ACGAGATGGGACACATCCAATATGACATGGCATATGCCAGGCAACCTTTCCTGCTAAGAAACGGAGCCAA
TGAAGGGTTCCATGAAGCTGTTGGAGAAATCATGTCACTTTCTGCAGCTACCCCCAAGCATCTGAAATCC
ATTGGTCTTCTGCCATCCGATTTTCAAGAAGATAGCGAAACAGAGATAAACTTCCTACTGAAACAGGCAT
TGACAATTGTTGGAACACTACCGTTTACTTACATGTTAGAGAAGTGGAGGTGGATGGTCTTTCGGGGTGA
AATTCCCAAAGAGCAGTGGATGAAAAAGTGGTGGGAGATGAAGCGGGAGATCGTTGGTGTGGTGGAGCCT
CTGCCTCATGATGAAACATACTGTGACCCTGCATCTCTGTTCCATGTTTCTAATGATTACTCATTCATTC
GATATTACACAAGGACCATTTACCAATTCCAGTTTCAAGAAGCTCTTTGTCAAGCAGCTAAGTATAATGG
TTCTCTGCACAAATGTGACATCTCAAATTCCACTGAAGCTGGGCAGAAGTTGCTCAAGATGCTGAGTCTT
GGAAATTCAGAGCCCTGGACCAAAGCCTTGGAAAATGTGGTAGGAGCAAGGAATATGGATGTAAAACCAC
TGCTCAATTACTTCCAACCGTTGTTTGACTGGCTGAAAGAGCAGAACAGAAATTCTTTTGTGGGGTGGAA
CACTGAATGGAGCCCATATGCCGACCAAAGCATTAAAGTGAGGATAAGCCTAAAATCAGCTCTTGGAGCT
AATGCATATGAATGGACCAACAACGAAATGTTCCTGTTCCGATCATCTGTTGCATATGCCATGAGAAAGT
ATTTTTCAATAATCAAAAACCAGACAGTTCCTTTTCTAGAGGAAGATGTACGAGTGAGTGATTTGAAACC
AAGAGTCTCCTTCTACTTCTTTGTCACCTCACCCCAAAATGTGTCTGATGTCATTCCTAGAAGTGAAGTT
GAAGATGCCATCAGGATGTCTCGGGGCCGCATCAATGATGTCTTTGGCCTGAATGATAACAGCCTGGAGT
TTCTGGGGATTCACCCAACACTTGAGCCACCTTACCAGCCTCCTGTCACCATATGGCTGATTATTTTTGG
TGTTGTGATGGCACTGGTAGTGGTTGGCATCATCATCCTGATTGTCACTGGCATCAAAGGTCGAAAGAAG
AAAAATGAAACAAAAAGAGAAGAGAACCCTTATGACTCGATGGACATTGGAAAAGGAGAAAGCAATGCAG
GATTCCAAAACAGTGATGATGCTCAGACTTCCTTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR210755 protein sequence
Red=Cloning site Green=Tags(s)

MSSSSWLLLSLVAVTTAQSLTEENAKTFLNNFNQEAEDLSYQSSLASWNYNTNITEENAQKMSEAAAKWS
AFYEEQSKTAQSFSLQEIQTPIIKRQLQALQQSGSSALSADKNKQLNTILNTMSTIYSTGKVCNPKNPQE
CLLLEPGLDEIMATSTDYNSRLWAWEGWRAEVGKQLRPLYEEYVVLKNEMARANNYNDYGDYWRGDYEAE
GADGYNYNRNQLIEDVERTFAEIKPLYEHLHAYVRRKLMDTYPSYISPTGCLPAHLLGDMWGRFWTNLYP
LTVPFAQKPNIDVTDAMMNQGWDAERIFQEAEKFFVSVGLPHMTQGFWANSMLTEPADGRKVVCHPTAWD
LGHGDFRIKMCTKVTMDNFLTAHHEMGHIQYDMAYARQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
IGLLPSDFQEDSETEINFLLKQALTIVGTLPFTYMLEKWRWMVFRGEIPKEQWMKKWWEMKREIVGVVEP
LPHDETYCDPASLFHVSNDYSFIRYYTRTIYQFQFQEALCQAAKYNGSLHKCDISNSTEAGQKLLKMLSL
GNSEPWTKALENVVGARNMDVKPLLNYFQPLFDWLKEQNRNSFVGWNTEWSPYADQSIKVRISLKSALGA
NAYEWTNNEMFLFRSSVAYAMRKYFSIIKNQTVPFLEEDVRVSDLKPRVSFYFFVTSPQNVSDVIPRSEV
EDAIRMSRGRINDVFGLNDNSLEFLGIHPTLEPPYQPPVTIWLIIFGVVMALVVVGIIILIVTGIKGRKK
KNETKREENPYDSMDIGKGESNAGFQNSDDAQTSF

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001130513
ORF Size 2418 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001130513.1, NP_001123985.1
RefSeq Size 3566 bp
RefSeq ORF 2418 bp
Locus ID 70008
UniProt ID Q8R0I0
Cytogenetics X 76.12 cM
MW 92.4 kDa
Gene Summary Carboxypeptidase which converts angiotensin I to angiotensin 1-9, a peptide of unknown function, and angiotensin II to angiotensin 1-7, a vasodilator. Also able to hydrolyze apelin-13 and dynorphin-13 with high efficiency. May be an important regulator of heart function. May have a protective role in acute lung injury. Plays an important role in amino acid transport by acting as binding partner of amino acid transporter SLC6A19, regulating its trafficking on the cell surface and its activity (PubMed:19185582).[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "Ace2"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.