Arhgap24 (BC023344) Mouse Tagged ORF Clone

CAT#: MR209791

Arhgap24 (Myc-DDK-tagged) - Mouse Rho GTPase activating protein 24 (cDNA clone MGC:32510 IMAGE:5064885)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 691.00


Availability*
5 Days

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Arhgap24 (BC023344) Mouse Tagged ORF Clone
Symbol Arhgap24
Synonyms MGC38749
Vector pCMV6-Entry
Sequence Data
>MR209791 representing BC023344
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAGCCAATCATGAGAGCTATCTCCTCATGGCGAGCACCCAGAATGACATGGAAGACTGGGTGAAGT
CCATCCGCCGAGTCATATGGGGACCTTTTGGAGGAGGTATTTTTGGACAGAAACTGGAAGACACAGTCCG
ATATGAAAAGAGGTACGGGAACCGGCTGGCACCCATGCTGGTGGAGCAGTGTGTGGACTTCATCCGACAG
CGGGGGCTGAAGGAAGAAGGCCTCTTCCGGCTGCCGGGCCAGGCGAACCTGGTCAAGGAGCTCCAGGATG
CGTTCGACTGTGGAGAGAAGCCCTCCTTCGACAGCAACACCGACGTCCACACTGTGGCATCCCTGCTGAA
ATTGTATCTCCGAGAACTTCCAGAGCCCGTCGTTCCTTATGCAAAGTATGAAGACTTTTTGTCCTGCGCC
ACGCTGCTCAGTAAGGAGGAAGAAGCAGGTGTTAAGGAGCTAATGAAACAAGTGAAGAGTTTGCCTGTGG
TTAACTACAACCTTCTGAAGTACATTTGCAGGTTCCTGGATGAAGTGCAGTCCTATTCAGGAGTTAACAA
GATGAGCGCACAGAACTTGGCAACTGTCTTCGGTCCTAACATCCTGCGCCCAAAGGTGGAAGATCCCTTG
ACCATCATGGAGGGCACTGTGGTGGTCCAGCAGTTAATGTCAGTGATGATTAGTAAGCATGATCGACTCT
TCCCCAAAGACACAGAACCACAAAGCAAGCCCCAAGACGGCCCGAACAGCAATAATAACGATGGTCATAA
GAAAGCCACCATGGGTCAGTTGCAGAACAAAGAAAACAATAATACCAAGGAGAGCCCCGTCAGAAGGTGC
TCTTGGGACAAGCCTGAATCCCCCCAGAGAAGCAGCGTGGACAATGGATCCCCCACAGCCCTATCAGGCA
GCAAAACCAACAGCCCAAGGAACAGTATCCACAAGCTGGATATTTCCAGGAGCCCCCCTCTCATGGTCAA
AAAGAACCCAGCCTTCAACAAGGGCAGTGGGATTGTCACCAACGGGTCATTCAGCAGCAGCAATGCAGAA
GGTGTCGAGAAGCCTCAAACTACTCCTAATGGGAGTTTACAAGCCAGAAGGACCTCTTCACTGAAGAGTT
CTGGTACCAAAATGGGCACTCACAGTGTACAGAATGGCACTGTCCGCATGGGTATTCTGAACACTGACAC
ACTAGGGAATTCCTTGAACGGCCGGAGCATGAGTTGGCTGCCCAATGGCTATGTGACCCTGAGAGATAAC
AAACAGAAGGAGCCAGCAGGAGAGTCAGGCCAGCACAACAGACTCTCCACCTACGACAATGTCCACCAGC
AGTTCTCCTCGATGAGCCTCGACGACAAGCACAGCGTGGACAGTGCCACGTGGTCCACCTCCTCCTGCGA
AATCTCCCTCCCTGAGAACTCCAATTCCTGCCGCTCCTCTACCACCACGTGCCCAGAGCAAGACTTCTAC
GTTGGGAACTTTGAGGACCCTGTTTTAGACGGCCCACCTCAGGATGATCTTTCCCATCCCGGGGACTATG
AGAACAAAAGTGACCGCAGGAGCGTAGGGGGCCGAAGCAGCCGCGCCACGAGCAGCAGCGATAACAGCGA
GACATTCGTGGGCAACACCAGCAGCAACCACAGTGCACTTCACAGTTTAGTTTCCAGCCTGAAGCAGGAG
ATGACCAAACAGAAGATCGAGTATGAGTCCAGGATAAAAAGCTTAGAACAGCGGAATTTGACTTTGGAAA
CGGAAATGCTGAGCCTCCATGACGAACTGGATCAAGAGAGGAAAAAGTTCACCATGATAGAAATCAAGAT
GAGAAACGCTGAGCGCGCAAAGGAGGATGCGGAGAAAAGGAACGACATGCTCCAGAAGGAGATGGAGCAG
TTCTTCTCCACATTTGGAGACCTGACAGTGGAACCCAGGAGAAGCGAGAGAGGAAACACAATCTGGATCC
AG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR209791 representing BC023344
Red=Cloning site Green=Tags(s)

MTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQ
RGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVVPYAKYEDFLSCA
TLLSKEEEAGVKELMKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSAQNLATVFGPNILRPKVEDPL
TIMEGTVVVQQLMSVMISKHDRLFPKDTEPQSKPQDGPNSNNNDGHKKATMGQLQNKENNNTKESPVRRC
SWDKPESPQRSSVDNGSPTALSGSKTNSPRNSIHKLDISRSPPLMVKKNPAFNKGSGIVTNGSFSSSNAE
GVEKPQTTPNGSLQARRTSSLKSSGTKMGTHSVQNGTVRMGILNTDTLGNSLNGRSMSWLPNGYVTLRDN
KQKEPAGESGQHNRLSTYDNVHQQFSSMSLDDKHSVDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFY
VGNFEDPVLDGPPQDDLSHPGDYENKSDRRSVGGRSSRATSSSDNSETFVGNTSSNHSALHSLVSSLKQE
MTKQKIEYESRIKSLEQRNLTLETEMLSLHDELDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQKEMEQ
FFSTFGDLTVEPRRSERGNTIWIQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN BC023344
ORF Size 1962 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq BC023344
RefSeq Size 2732
RefSeq ORF 1964
Locus ID 231532
Cytogenetics 5|5 E5
MW 100.1 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)