Sh3glb1 (NM_019464) Mouse Tagged ORF Clone

CAT#: MR205615

  • TrueORF®

Sh3glb1 (Myc-DDK-tagged) - Mouse SH3-domain GRB2-like B1 (endophilin) (Sh3glb1)

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro


  "NM_019464" in other vectors (6)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 686.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Sh3glb1 Antibody - N-terminal region
    • 100 ul

USD 539.00

Other products for "Sh3glb1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Sh3glb1
Synonyms AA409932; AI314629; AU015566; Bif-1; mKIAA0491
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR205615 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACATCATGGATTTCAACGTGAAGAAGCTGGCGGCCGACGCGGGCACCTTCCTCAGCCGGGCCGTGC
AGTTCACAGAAGAAAAGCTTGGCCAGGCAGAGAAGACAGAACTGGACGCTCACCTGGAAAACCTCCTTAG
CAAAGCTGAATGTACCAAAATATGGACAGAAAAGATAATGAAGCAGACCGAAGTGCTGTTGCAGCCAAAT
CCAAATGCCAGGATAGAAGAATTTGTTTATGAGAAACTGGATAGAAAAGCACCAAGTCGTATAAACAACC
CGGAACTTTTGGGACAATATATGATTGATGCAGGAACTGAGTTTGGCCCAGGGACAGCTTATGGAAATGC
CCTTATTAAATGTGGAGAAACACAGAAGCGAATTGGAACAGCTGACCGAGAGCTGATTCAAACATCAGCC
TTAAATTTCCTCACTCCTTTAAGAAACTTTATAGAAGGGGATTACAAAACAATCGCAAAAGAAAGGAAAC
TATTACAGAATAAGAGACTGGATTTGGATGCTGCAAAAACAAGACTAAAAAAGGCAAAAGCTGCAGAAAC
TAAAAGTTCATCTGAACAGGAATTGAGAATAACTCAAAGTGAATTTGATCGTCAGGCAGAGATTACCCGA
CTCCTGCTTGAGGGAATCAGCAGTACACACGCCCATCATCTCCGCTGTCTGAATGACTTTGTAGAAGCCC
AGATGACTTACTATGCACAGTGTTACCAGTATATGCTAGACCTACAGAAGCAACTGGGAAGTTTTCCATC
CAATTATCTTTCTAACAACAATCAGACCTCTGGGACACCAGTGCCATATGCTTTGTCAAATGCAATTGGT
CCTTCTGCCCAGGCTTCAACGGGTAGCCTTGTAATCACCTGTCCTTCTAACCTCAATGACCTTAAAGAAT
CCAGCAACAACAGGAAGGCTAGGGTCCTCTATGATTATGATGCTGCAAATAGCACTGAACTGTCACTCCT
GGCCGATGAGGTAATCACTGTGTTCAGTGTCGTTGGAATGGACTCCGACTGGCTAATGGGAGAGAGAGGA
AATCAAAAGGGCAAGGTGCCAATTACCTACTTAGAACTTCTCAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR205615 protein sequence
Red=Cloning site Green=Tags(s)

MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPN
PNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSA
LNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETKSSSEQELRITQSEFDRQAEITR
LLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSGTPVPYALSNAIG
PSAQASTGSLVITCPSNLNDLKESSNNRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERG
NQKGKVPITYLELLN

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_019464
ORF Size 1098 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_019464.3
RefSeq Size 5903 bp
RefSeq ORF 1098 bp
Locus ID 54673
UniProt ID Q9JK48
Cytogenetics 3 H2
MW 40.9 kDa
Gene Summary May be required for normal outer mitochondrial membrane dynamics. Required for coatomer-mediated retrograde transport in certain cells (PubMed:17086176). May recruit other proteins to membranes with high curvature. May promote membrane fusion (By similarity). Involved in activation of caspase-dependent apoptosis by promoting BAX/BAK1 activation (PubMed:16227588). Isoform 1 acts proapoptotic in fibroblasts (PubMed:24523556). Involved in caspase-independent apoptosis during nutrition starvation and involved in the regulation of autophagy. Activates lipid kinase activity of PIK3C3 during autophagy probably by associating with the PI3K complex II (PI3KC3-C2). Associated with PI3KC3-C2 during autophagy may regulate the trafficking of ATG9A from the Golgi complex to the peripheral cytoplasm for the formation of autophagosomes by inducing Golgi membrane tubulation and fragmentation. Involved in regulation of degradative endocytic trafficking and cytokinesis, probably in the context of PI3KC3-C2 (By similarity). Isoform 2 acts antiapoptotic in neuronal cells; involved in maintenance of mitochondrial morphology and promotes neuronal viability (PubMed:24523556).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.