Akr1a1 (NM_021473) Mouse Tagged ORF Clone

SKU
MR204727
Akr1a1 (Myc-DDK-tagged) - Mouse aldo-keto reductase family 1, member A4 (aldehyde reductase) (Akr1a4)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Akr1a1
Synonyms 2610201A18Rik; Akr1a4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR204727 representing NM_021473
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGGCCTCCAGTGTCCTCCTGCACACTGGACAGAAGATGCCTCTGATTGGTCTGGGGACATGGAAGA
GTGAGCCTGGTCAGGTGAAAGCAGCCATTAAACATGCCCTTAGCGCAGGCTACCGCCACATTGATTGTGC
TTCTGTATATGGCAATGAAACTGAGATTGGGGAGGCCCTGAAGGAGAGTGTGGGGTCAGGCAAGGCAGTC
CCTCGAGAGGAGCTGTTTGTGACATCCAAGCTGTGGAATACTAAGCACCACCCTGAGGATGTAGAACCTG
CCCTCCGGAAGACACTGGCTGATCTGCAACTGGAGTATTTGGACCTCTATTTGATGCACTGGCCTTATGC
CTTTGAGCGGGGAGACAATCCCTTTCCCAAGAATGCCGATGGAACTGTCAGATATGACTCAACTCACTAT
AAAGAGACCTGGAAGGCTCTGGAGGTACTGGTGGCAAAGGGGCTGGTGAAAGCCCTGGGCTTGTCCAACT
TCAACAGTCGGCAGATTGATGATGTCCTCAGTGTGGCCTCTGTGCGCCCAGCTGTCTTGCAGGTGGAATG
CCATCCATACCTGGCTCAGAATGAGCTCATTGCCCACTGTCACGCACGGGGCTTGGAGGTGACTGCTTAT
AGCCCCTTGGGTTCCTCTGACCGTGCTTGGCGCCATCCTGATGAGCCAGTCCTGCTTGAAGAACCAGTAG
TCTTGGCACTAGCTGAAAAACATGGCCGATCTCCAGCTCAGATCTTGCTTAGATGGCAGGTTCAGCGGAA
AGTGATCTGCATCCCCAAAAGCATCAATCCTTCCCGCATCCTTCAGAACATTCAGGTATTTGATTTCACC
TTTAGCCCAGAGGAGATGAAACAATTAGATGCTCTGAACAAAAATTGGCGGTATATTGTGCCCATGATTA
CGGTGGATGGGAAGAGGGTTCCCAGAGATGCTGGACACCCTCTGTATCCCTTTAATGACCCATAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR204727 representing NM_021473
Red=Cloning site Green=Tags(s)

MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKHALSAGYRHIDCASVYGNETEIGEALKESVGSGKAV
PREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVRYDSTHY
KETWKALEVLVAKGLVKALGLSNFNSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCHARGLEVTAY
SPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSINPSRILQNIQVFDFT
FSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_021473
ORF Size 975 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021473.3, NP_067448.1
RefSeq Size 1435 bp
RefSeq ORF 978 bp
Locus ID 58810
UniProt ID Q9JII6
Cytogenetics 4 D1
MW 36.6 kDa
Summary Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols. Displays enzymatic activity towards endogenous metabolites such as aromatic and aliphatic aldehydes, ketones, monosaccharides and bile acids, with a preference for negatively charged substrates, such as glucuronate and succinic semialdehyde (By similarity) (PubMed:22820017, PubMed:15769935, PubMed:20410296). Plays an important role in ascorbic acid biosynthesis by catalyzing the reduction of D-glucuronic acid and D-glucurono-gamma-lactone (PubMed:20410296, PubMed:15769935, PubMed:22820017). Functions as a detoxifiying enzyme by reducing a range of toxic aldehydes. Reduces methylglyoxal and 3-deoxyglucosone, which are present at elevated levels under hyperglycemic conditions and are cytotoxic (By similarity). Involved in the detoxification of lipid-derived aldehydes like acrolein (By similarity). Plays a role in the activation of procarcinogens, such as polycyclic aromatic hydrocarbon trans-dihydrodiols, and in the metabolism of various xenobiotics and drugs (By similarity). Displays no reductase activity towards retinoids (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Akr1a1 (NM_021473) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC210185 Akr1a1 (untagged) - Mouse aldo-keto reductase family 1, member A4 (aldehyde reductase) (Akr1a4), (10ug) 10 ug
$330.00
MG204727 Akr1a1 (tGFP-tagged) - Mouse aldo-keto reductase family 1, member A4 (aldehyde reductase) (Akr1a4) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
MR204727L3 Lenti ORF clone of Akr1a1 (Myc-DDK-tagged) - Mouse aldo-keto reductase family 1, member A4 (aldehyde reductase) (Akr1a4) 10 ug
$600.00
MR204727L4 Lenti ORF clone of Akr1a1 (mGFP-tagged) - Mouse aldo-keto reductase family 1, member A4 (aldehyde reductase) (Akr1a4) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.