Cd47 (NM_010581) Mouse Tagged ORF Clone

SKU
MR204706
Cd47 (Myc-DDK-tagged) - Mouse CD47 antigen (Rh-related antigen, integrin-associated signal transducer) (Cd47)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cd47
Synonyms 9130415E20Rik; AA407862; AI848868; AW108519; B430305P08Rik; IAP; Itgp
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR204706 representing NM_010581
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGCCCTTGGCGGCGGCGCTGTTGCTGGGCTCCTGCTGCTGCGGTTCAGCTCAACTACTGTTTAGTA
ACGTCAACTCCATAGAGTTCACTTCATGCAATGAAACTGTGGTCATCCCTTGCATCGTCCGTAATGTGGA
GGCGCAAAGCACCGAAGAAATGTTTGTGAAGTGGAAGTTGAACAAATCGTATATTTTCATCTATGATGGA
AATAAAAATAGCACTACTACAGATCAAAACTTTACCAGTGCAAAAATCTCAGTCTCAGACTTAATCAATG
GCATTGCCTCTTTGAAAATGGATAAGCGCGATGCCATGGTGGGAAACTACACTTGCGAAGTGACAGAGTT
ATCCAGAGAAGGCAAAACAGTTATAGAGCTGAAAAACCGCACGGCCTTCAACACTGACCAAGGATCAGCC
TGTTCTTACGAGGAGGAGAAAGGAGGTTGCAAATTAGTTTCGTGGTTTTCTCCAAATGAAAAGATCCTCA
TTGTTATTTTCCCAATTTTGGCTATACTCCTGTTCTGGGGAAAGTTTGGTATTTTAACACTCAAATATAA
ATCCAGCCATACGAATAAGAGAATCATTCTGCTGCTCGTTGCCGGGCTGGTGCTCACAGTCATCGTGGTT
GTTGGAGCCATCCTTCTCATCCCAGGAGAAAAGCCCGTGAAGAATGCTTCTGGACTTGGCCTCATTGTGA
TCTCTACGGGGATATTAATACTACTTCAGTACAATGTGTTTATGACAGCTTTTGGAATGACCTCTTTCAC
CATTGCCATATTGATCACTCAAGTGCTGGGCTACGTCCTTGCTTTGGTCGGGCTGTGTCTCTGCATCATG
GCATGTGAGCCAGTGCACGGCCCCCTTTTGATTTCAGGTTTGGGGATCATAGCTCTAGCAGAACTACTTG
GATTAGTTTATATGAAGTTTGTCGCTTCCAACCAGAGGACTATCCAACCTCCTAGGAATAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR204706 representing NM_010581
Red=Cloning site Green=Tags(s)

MWPLAAALLLGSCCCGSAQLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDG
NKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSA
CSYEEEKGGCKLVSWFSPNEKILIVIFPILAILLFWGKFGILTLKYKSSHTNKRIILLLVAGLVLTVIVV
VGAILLIPGEKPVKNASGLGLIVISTGILILLQYNVFMTAFGMTSFTIAILITQVLGYVLALVGLCLCIM
ACEPVHGPLLISGLGIIALAELLGLVYMKFVASNQRTIQPPRNR

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_010581
ORF Size 972 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_010581.2
RefSeq Size 1928 bp
RefSeq ORF 975 bp
Locus ID 16423
UniProt ID Q61735
Cytogenetics 16 B5
MW 35.8 kDa
Summary Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Cd47 (NM_010581) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC208027 Cd47 (untagged) - Mouse CD47 antigen (Rh-related antigen, integrin-associated signal transducer) (Cd47), (10ug) 10 ug
$450.00
MG204706 Cd47 (tGFP-tagged) - Mouse CD47 antigen (Rh-related antigen, integrin-associated signal transducer) (Cd47) 10 ug
$650.00
MR204706L1 Lenti ORF clone of Cd47 (Myc-DDK-tagged) - Mouse CD47 antigen (Rh-related antigen, integrin-associated signal transducer) (Cd47) 10 ug
$750.00
MR204706L2 Lenti ORF clone of Cd47 (mGFP-tagged) - Mouse CD47 antigen (Rh-related antigen, integrin-associated signal transducer) (Cd47) 10 ug
$750.00
MR204706L3 Lenti ORF clone of Cd47 (Myc-DDK-tagged) - Mouse CD47 antigen (Rh-related antigen, integrin-associated signal transducer) (Cd47) 10 ug
$750.00
MR204706L4 Lenti ORF clone of Cd47 (mGFP-tagged) - Mouse CD47 antigen (Rh-related antigen, integrin-associated signal transducer) (Cd47) 10 ug
$750.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.