Lgals9 (NM_001159301) Mouse Tagged ORF Clone

SKU
MR204650
Lgals9 (Myc-DDK-tagged) - Mouse lectin, galactose binding, soluble 9 (Lgals9), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Lgals9
Synonyms AA407335; AI194909; AI265545; gal-9; galectin-9; Lgals5; LGALS35
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR204650 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCTCTTCAGTGCCCAGTCTCCATACATTAACCCGATCATCCCCTTTACTGGACCAATCCAAGGAG
GGCTGCAGGAGGGACTTCAGGTGACCCTCCAGGGGACTACCAAGAGTTTTGCACAAAGGTTTGTGGTGAA
CTTTCAGAACAGCTTCAATGGAAATGACATTGCCTTCCACTTCAACCCCCGGTTTGAGGAAGGAGGGTAT
GTGGTTTGCAACACGAAGCAGAACGGACAGTGGGGGCCTGAGGAGAGAAAGATGCAGATGCCCTTCCAGA
AGGGGATGCCCTTTGAGCTTTGCTTCCTGGTGCAGAGGTCAGAGTTCAAGGTGATGGTGAACAAGAAATT
CTTTGTGCAGTACCAACACCGCGTACCCTACCACCTCGTGGACACCATCGCTGTCTCCGGCTGCTTGAAG
CTGTCCTTTATCACCTTCCAGACTCAGGACTTTCGTCCTGCCCACCAGGCACCCATGGCTCAAACTACCA
TCCATATGGTTCACAGCACCCCTGGACAGATGTTCTCTACTCCTGGAATCCCTCCTGTGGTGTACCCCAC
CCCAGCCTATACCATACCTTTCTACACCCCCATTCCAAATGGGCTTTACCCGTCCAAGTCCATCATGATA
TCAGGCAATGTCTTGCCAGATGCTACGAGGTTCCATATCAACCTTCGCTGTGGAGGTGACATTGCTTTCC
ACCTGAACCCCCGTTTCAATGAGAATGCTGTTGTCCGAAACACTCAGATCAACAACTCCTGGGGGCAGGA
AGAGCGAAGTCTGCTTGGGAGGATGCCCTTCAGTCGAGGCCAGAGCTTCTCGGTGTGGATCATATGCGAA
GGTCACTGCTTCAAGGTGGCTGTGAATGGTCAACACATGTGTGAATATTACCACCGCCTGAAGAACTTGC
AGGATATCAACACTCTAGAAGTGGCGGGTGATATCCAGCTGACCCACGTGCAGACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR204650 protein sequence
Red=Cloning site Green=Tags(s)

MALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGY
VVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLK
LSFITFQTQDFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMI
SGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICE
GHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001159301
ORF Size 966 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001159301.1, NP_001152773.1
RefSeq Size 1493 bp
RefSeq ORF 969 bp
Locus ID 16859
UniProt ID O08573
Cytogenetics 11 B5
MW 36.5 kDa
Summary Binds galactosides (By similarity). Has high affinity for the Forssman pentasaccharide (By similarity). Ligand for HAVCR2/TIM3 (By similarity). Binding to HAVCR2 induces T-helper type 1 lymphocyte (Th1) death (By similarity). Also stimulates bactericidal activity in infected macrophages by causing macrophage activation and IL1B secretion which restricts intracellular bacterial growth (PubMed:20937702). Ligand for P4HB; the interaction retains P4HB at the cell surface of Th2 T-helper cells, increasing disulfide reductase activity at the plasma membrane, altering the plasma membrane redox state and enhancing cell migration (PubMed:21670307). Ligand for CD44; the interaction enhances binding of SMAD3 to the FOXP3 promoter, leading to up-regulation of FOXP3 expression and increased induced regulatory T (iTreg) cell stability and suppressive function (PubMed:25065622). Promotes ability of mesenchymal stromal cells to suppress T-cell proliferation (By similarity). Expands regulatory T-cells and induces cytotoxic T-cell apoptosis following virus infection (By similarity). Activates ERK1/2 phosphorylation inducing cytokine (IL-6, IL-8, IL-12) and chemokine (CCL2) production in mast and dendritic cells (By similarity). Inhibits degranulation and induces apoptosis of mast cells (By similarity). Induces maturation and migration of dendritic cells (By similarity). Inhibits natural killer (NK) cell function (PubMed:23408620). Can transform NK cell phenotype from peripheral to decidual during pregnancy (By similarity). Astrocyte derived galectin-9 enhances microglial TNF production (PubMed:25158758). May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. May provide the molecular basis for urate flux across cell membranes, allowing urate that is formed during purine metabolism to efflux from cells and serving as an electrogenic transporter that plays an important role in renal and gastrointestinal urate excretion (By similarity). Highly selective to the anion urate (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Lgals9 (NM_001159301) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MR204650L3 Lenti ORF clone of Lgals9 (Myc-DDK-tagged) - Mouse lectin, galactose binding, soluble 9 (Lgals9), transcript variant 2 10 ug
$600.00
MR204650L4 Lenti ORF clone of Lgals9 (mGFP-tagged) - Mouse lectin, galactose binding, soluble 9 (Lgals9), transcript variant 2 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.