Otub1 (NM_134150) Mouse Tagged ORF Clone

SKU
MR203606
Otub1 (Myc-DDK-tagged) - Mouse OTU domain, ubiquitin aldehyde binding 1 (Otub1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Otub1
Synonyms AI850305
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR203606 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGAGGAACCTCAGCAGCAGAAGCAGGAGCCACTGGGTAGCGACTCCGAAGGTGTTAACTGTT
TGGCCTATGATGAAGCCATTATGGCTCAGCAGGACCGAATTCAGCAAGAGATTGCTGTGCAGAATCCTCT
GGTGTCAGAGCGGCTGGAACTCTCAGTCCTGTACAAGGAGTATGCTGAGGATGACAACATCTACCAACAG
AAGATCAAGGACCTCCACAAAAAGTACTCATACATACGGAAGACCCGGCCTGATGGCAACTGCTTCTACC
GAGCGTTTGGCTTCTCCCACCTGGAGGCACTGCTAGATGACAGCAAGGAACTGCAGCGGTTCAAAGCCGT
GTCTGCCAAGAGTAAAGAGGACCTGGTATCCCAGGGCTTCACTGAATTCACAATTGAAGACTTCCACAAC
ACGTTCATGGACCTTATCGAGCAGGTGGAGAAGCAGACCTCAGTAGCTGACCTGCTGGCCTCCTTCAATG
ACCAGAGCACCTCAGACTACCTTGTGGTCTACCTGCGACTGCTCACCTCAGGCTACCTACAGCGGGAGAG
CAAGTTCTTCGAGCACTTCATCGAGGGTGGCCGGACTGTTAAGGAGTTCTGCCAGCAGGAGGTGGAACCC
ATGTGCAAGGAGAGCGACCACATCCACATCATAGCCCTGGCCCAGGCCCTCAGTGTGTCCATCCAAGTGG
AGTACATGGACCGCGGCGAGGGCGGCACCACCAACCCACACGTCTTCCCCGAGGGCTCCGAGCCCAAGGT
CTACCTTCTCTACCGACCTGGACACTACGATATCCTCTACAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR203606 protein sequence
Red=Cloning site Green=Tags(s)

MAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQ
KIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHN
TFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEP
MCKESDHIHIIALAQALSVSIQVEYMDRGEGGTTNPHVFPEGSEPKVYLLYRPGHYDILYK

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_134150
ORF Size 813 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_134150.2, NP_598911.1
RefSeq Size 1677 bp
RefSeq ORF 816 bp
Locus ID 107260
UniProt ID Q7TQI3
Cytogenetics 19 A
MW 31.3 kDa
Summary Hydrolase that can specifically remove compared to 'Lys-48'-linked conjugated ubiquitin from proteins and plays an important regulatory role at the level of protein turnover by preventing degradation. Regulator of T-cell anergy, a phenomenon that occurs when T-cells are rendered unresponsive to antigen rechallenge and no longer respond to their cognate antigen. Acts via its interaction with RNF128/GRAIL. Surprisingly, it regulates RNF128-mediated ubiquitination, but does not deubiquitinate polyubiquitinated RNF128. Deubiquitinates estrogen receptor alpha (ESR1). Mediates deubiquitination of 'Lys-48'-linked polyubiquitin chains, but not 'Lys-63'-linked polyubiquitin chains. Not able to cleave di-ubiquitin. Also capable of removing NEDD8 from NEDD8 conjugates, but with a much lower preference compared to 'Lys-48'-linked ubiquitin.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Otub1 (NM_134150) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC207822 Otub1 (untagged) - Mouse OTU domain, ubiquitin aldehyde binding 1 (Otub1), (10ug) 10 ug
$480.00
MG203606 Otub1 (tGFP-tagged) - Mouse OTU domain, ubiquitin aldehyde binding 1 (Otub1) 10 ug
$650.00
MR203606L1 Lenti ORF clone of Otub1 (Myc-DDK-tagged) - Mouse OTU domain, ubiquitin aldehyde binding 1 (Otub1) 10 ug
$750.00
MR203606L2 Lenti ORF clone of Otub1 (mGFP-tagged) - Mouse OTU domain, ubiquitin aldehyde binding 1 (Otub1) 10 ug
$750.00
MR203606L3 Lenti ORF clone of Otub1 (Myc-DDK-tagged) - Mouse OTU domain, ubiquitin aldehyde binding 1 (Otub1) 10 ug
$750.00
MR203606L4 Lenti ORF clone of Otub1 (mGFP-tagged) - Mouse OTU domain, ubiquitin aldehyde binding 1 (Otub1) 10 ug
$750.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.