Mapre1 (NM_007896) Mouse Tagged ORF Clone

SKU
MR203552
Mapre1 (Myc-DDK-tagged) - Mouse microtubule-associated protein, RP/EB family, member 1 (Mapre1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Mapre1
Synonyms 5530600P05Rik; AI462499; AI504412; AW260097; BIM1p; D2Ertd459e; Eb1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR203552 representing NM_007896
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGTGAATGTGTACTCTACGTCAGTCACCAGTGATAACCTAAGTCGACATGACATGCTGGCTTGGA
TCAATGAATCTCTGCAGTTGAATCTGACAAAGATAGAACAGTTGTGTTCAGGGGCTGCATATTGTCAGTT
TATGGACATGCTCTTCCCTGGATCCATTGCCTTGAAGAAAGTGAAATTCCAAGCTAAGCTAGAACATGAA
TATATCCAGAACTTCAAAATACTACAAGCAGGCTTCAAGAGGATGGGCGTTGACAAAATAATTCCTGTGG
ATAAATTAGTAAAAGGAAAATTTCAGGACAATTTTGAATTTGTTCAATGGTTCAAGAAGTTTTTTGATGC
AAATTATGATGGAAAAGAGTATGATCCTGTAGCTGCCAGACAAGGTCAAGAAACTGCAGTGGCTCCTTCT
CTTGTCGCCCCAGCTTTGAGTAAACCGAAGAAACCTCTCGGCTCCAGTACTGCAGCCCCACAGAGACCCA
TTGCAACACAGAGGACTACTGCAGCTCCTAAGGCTGGCCCCGGAATGGTGCGAAAGAATCCTGGTGTGGG
CAATGGAGATGATGAAGCAGCTGAATTGATGCAGCAGGTCAAAGTACTGAAGCTTACTGTTGAAGACTTG
GAGAAGGAGAGAGACTTCTACTTCGGAAAGCTAAGGAACATTGAACTGATTTGCCAGGAGAACGAGGGGG
AAAACGACCCTGTACTGCAGAGGATTGTAGATATTCTTTATGCCACAGATGAAGGCTTTGTGATACCTGA
TGAAGGGGGCCCACAGGAGGAACAAGAAGAGTAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR203552 representing NM_007896
Red=Cloning site Green=Tags(s)

MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHE
YIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKEYDPVAARQGQETAVAPS
LVAPALSKPKKPLGSSTAAPQRPIATQRTTAAPKAGPGMVRKNPGVGNGDDEAAELMQQVKVLKLTVEDL
EKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007896
ORF Size 804 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007896.3, NP_031922.1
RefSeq Size 7330 bp
RefSeq ORF 807 bp
Locus ID 13589
UniProt ID Q61166
Cytogenetics 2 75.95 cM
MW 30 kDa
Summary Plus-end tracking protein (+TIP) that binds to the plus-end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes cytoplasmic microtubule nucleation and elongation. May be involved in spindle function by stabilizing microtubules and anchoring them at centrosomes. Also acts as a regulator of minus-end microtubule organization: interacts with the complex formed by AKAP9 and PDE4DIP, leading to recruit CAMSAP2 to the Golgi apparatus, thereby tethering non-centrosomal minus-end microtubules to the Golgi, an important step for polarized cell movement. Promotes elongation of CAMSAP2-decorated microtubule stretches on the minus-end of microtubules. Acts as a regulator of autophagosome transport via interaction with CAMSAP2 (By similarity). May play a role in cell migration (PubMed:15311282).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Mapre1 (NM_007896) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC202404 Mapre1 (untagged) - Mouse microtubule-associated protein, RP/EB family, member 1 (Mapre1), (10ug) 10 ug
$300.00
MG203552 Mapre1 (tGFP-tagged) - Mouse microtubule-associated protein, RP/EB family, member 1 (Mapre1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
MR203552L3 Lenti ORF clone of Mapre1 (Myc-DDK-tagged) - Mouse microtubule-associated protein, RP/EB family, member 1 (Mapre1) 10 ug
$600.00
MR203552L4 Lenti ORF clone of Mapre1 (mGFP-tagged) - Mouse microtubule-associated protein, RP/EB family, member 1 (Mapre1) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.