Spin1 (NM_146043) Mouse Tagged ORF Clone

SKU
MR203454
Spin1 (Myc-DDK-tagged) - Mouse spindlin 1 (Spin1), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Spin1
Synonyms Spin
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR203454 representing NM_146043
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGACCCCATTCGGGAAGACACCTGGCCAACGGTCCAGAGCTGATGCAGGCCATGCTGGAGTATCTG
CAAACATGATGAAGAAGAGGACATCTCACAAAAAACATCGGACCAGTGTGGGACCAAGCAAGCCTGTGTC
CCAACCCCGGCGGAACATCGTAGGCTGCAGGATCCAGCATGGATGGAGAGAGGGCAATGGCCCTGTTACC
CAGTGGAAGGGGACTGTCCTGGACCAGGTGCCTGTGAATCCTTCCCTGTATCTTATAAAGTACGATGGAT
TTGACTGTGTTTATGGACTAGAACTTAATAAGGATGAAAGAGTTTCTGCACTGGAAGTCCTCCCTGATAG
AGTTGCAACATCTCGGATCAGCGATGCACACTTAGCGGACACAATGATCGGCAAAGCAGTGGAGCACATG
TTTGAGACAGAGGACGGCTCTAAAGATGAGTGGAGGGGGATGGTCTTGGCACGGGCGCCTGTCATGAACA
CATGGTTTTACATCACCTATGAGAAAGACCCTGTCTTGTACATGTACCAGCTCCTCGATGACTACAAAGA
AGGCGACCTCCGCATCATGCCTGATTCCAATGATTCGCCTCCAGCAGAAAGGGAGCCAGGAGAAGTTGTG
GACAGCCTGGTAGGCAAGCAAGTGGAATATGCCAAAGAAGACGGCTCGAAAAGGACTGGCATGGTCATCC
ACCAAGTAGAGGCCAAGCCCTCTGTCTATTTCATCAAGTTTGATGACGATTTCCATATTTACGTCTACGA
TTTGGTGAAAACATCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR203454 representing NM_146043
Red=Cloning site Green=Tags(s)

MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRTSVGPSKPVSQPRRNIVGCRIQHGWREGNGPVT
QWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHM
FETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVV
DSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_146043
ORF Size 786 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_146043.4, NP_666155.1
RefSeq Size 1064 bp
RefSeq ORF 789 bp
Locus ID 20729
UniProt ID Q61142
Cytogenetics 13 26.04 cM
MW 30.1 kDa
Summary Chromatin reader that specifically recognizes and binds histone H3 both trimethylated at 'Lys-4' and asymmetrically dimethylated at 'Arg-8' (H3K4me3 and H3R8me2a) and acts as an activator of Wnt signaling pathway downstream of PRMT2. In case of cancer, promotes cell cancer proliferation via activation of the Wnt signaling pathway (By similarity). Overexpression induces metaphase arrest and chromosomal instability (PubMed:18543248). Localizes to active rDNA loci and promotes the expression of rRNA genes. May play a role in cell-cycle regulation during the transition from gamete to embryo. Involved in oocyte meiotic resumption, a process that takes place before ovulation to resume meiosis of oocytes blocked in prophase I: may act by regulating maternal transcripts to control meiotic resumption (PubMed:23894536).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Spin1 (NM_146043) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC209447 Spin1 (untagged) - Mouse spindlin 1 (Spin1), transcript variant 2, (10ug) 10 ug
$330.00
MR203454L3 Lenti ORF clone of Spin1 (Myc-DDK-tagged) - Mouse spindlin 1 (Spin1), transcript variant 2 10 ug
$600.00
MR203454L4 Lenti ORF clone of Spin1 (mGFP-tagged) - Mouse spindlin 1 (Spin1), transcript variant 2 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.