Sirt3 (NM_001127351) Mouse Tagged ORF Clone

SKU
MR203304
Sirt3 (Myc-DDK-tagged) - Mouse sirtuin 3 (silent mating type information regulation 2, homolog) 3 (S. cerevisiae) (Sirt3), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Sirt3
Synonyms 2310003L23Rik; AI848213; Sir2l3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR203304 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGGGGCCGGCATCAGCACACCCAGTGGCATCCCGGACTTCAGATCCCCAGGGAGCGGCCTCTACA
GCAACCTTCAGCAGTATGACATCCCGTACCCTGAAGCCATCTTTGAACTTGGCTTTTTCTTTCACAACCC
CAAGCCCTTTTTCATGTTGGCCAAGGAGCTGTACCCTGGGCACTACAGGCCCAATGTCACTCACTACTTC
CTGAGGCTCCTCCACGACAAGGAGCTGCTTCTGCGGCTCTATACACAGAACATCGACGGGCTTGAGAGAG
CATCTGGGATCCCTGCCTCAAAGCTGGTTGAAGCCCACGGGACCTTTGTAACAGCTACATGCACGGTCTG
TCGAAGGTCCTTCCCAGGGGAAGACATATGGGCTGATGTGATGGCGGACAGGGTGCCCCGCTGCCCTGTC
TGTACTGGCGTTGTGAAACCCGACATTGTGTTCTTTGGGGAGCAGCTGCCTGCAAGGTTCCTACTCCATA
TGGCTGACTTCGCTTTGGCAGATCTGCTACTCATTCTTGGGACCTCCCTGGAGGTGGAGCCTTTTGCCAG
CTTGTCTGAAGCAGTACAGAAATCAGTGCCCCGACTGCTCATCAATCGAGACTTGGTGGGGCCGTTCGTT
CTGAGTCCTCGAAGGAAAGATGTGGTCCAGCTAGGGGATGTAGTTCATGGTGTGGAAAGGCTGGTGGACC
TCCTGGGGTGGACACAAGAACTGCTGGATCTTATGCAGCGGGAACGTGGCAAGCTGGATGGACAGGACAG
A


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR203304 protein sequence
Red=Cloning site Green=Tags(s)

MVGAGISTPSGIPDFRSPGSGLYSNLQQYDIPYPEAIFELGFFFHNPKPFFMLAKELYPGHYRPNVTHYF
LRLLHDKELLLRLYTQNIDGLERASGIPASKLVEAHGTFVTATCTVCRRSFPGEDIWADVMADRVPRCPV
CTGVVKPDIVFFGEQLPARFLLHMADFALADLLLILGTSLEVEPFASLSEAVQKSVPRLLINRDLVGPFV
LSPRRKDVVQLGDVVHGVERLVDLLGWTQELLDLMQRERGKLDGQDR

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001127351
ORF Size 771 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001127351.1, NP_001120823.1
RefSeq Size 1439 bp
RefSeq ORF 774 bp
Locus ID 64384
UniProt ID Q8R104
Cytogenetics 7 F4-F5
MW 28.8 kDa
Summary NAD-dependent protein deacetylase (PubMed:23835326, PubMed:17923681, PubMed:18794531, PubMed:21172655). Activates or deactivates mitochondrial target proteins by deacetylating key lysine residues (PubMed:23835326, PubMed:17923681, PubMed:18794531, PubMed:21172655). Known targets include ACSS1, IDH, GDH, PDHA1, SOD2, LCAD, SDHA and the ATP synthase subunit ATP5PO (PubMed:16790548, PubMed:18794531, PubMed:21172655). Contributes to the regulation of the cellular energy metabolism (PubMed:23835326). Important for regulating tissue-specific ATP levels (PubMed:18794531, PubMed:24252090). In response to metabolic stress, deacetylates transcription factor FOXO3 and recruits FOXO3 and mitochondrial RNA polymerase POLRMT to mtDNA to promote mtDNA transcription (PubMed:23283301).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Sirt3 (NM_001127351) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MG203304 Sirt3 (tGFP-tagged) - Mouse sirtuin 3 (silent mating type information regulation 2, homolog) 3 (S. cerevisiae) (Sirt3), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
MR203304L3 Lenti ORF clone of Sirt3 (Myc-DDK-tagged) - Mouse sirtuin 3 (silent mating type information regulation 2, homolog) 3 (S. cerevisiae) (Sirt3), transcript variant 2 10 ug
$600.00
MR203304L4 Lenti ORF clone of Sirt3 (mGFP-tagged) - Mouse sirtuin 3 (silent mating type information regulation 2, homolog) 3 (S. cerevisiae) (Sirt3), transcript variant 2 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.