Fam192a (NM_028221) Mouse Tagged ORF Clone

SKU
MR203248
Fam192a (Myc-DDK-tagged) - Mouse family with sequence similarity 192, member A (Fam192a)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Fam192a
Synonyms 1700001O11Rik; 2310065K24Rik; AI596259; Nip30
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR203248 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGGAGAGGACGATAGTAACCTTGTCATCAAAAAGAGGTTTGTGTCTGAGGCAGAGCTAGATGAGC
GGCGCAAAAGGAGGCAAGAAGAATGGGAGAAAGTGCGAAAACCAGAAGACCCAAAAGAATGTCCAGAGGA
GGCGTATGACCCTCGGTCTCTGTACGAACGGCTGCAGGAACAGAAAGACAGGAAGCAGCAGGAGTATGAG
GAGCAATTCAAATTCAAAAACATGGTAAGAGGGTTAGACGAAGATGAGACCAACTTCCTTGATGAGGTTT
CTCGGCAGCAGGATCTGATAGAGAAGCAGCGGCGAGAAGAAGAACTAGAGGAACTGAAGGAGTACAGAAG
TAATCTCAACAAGGTTGGAATTTCTGCAGAAAATAAAGAAGTAGAGAAGAAGCTGGCCGTGAAACCCATA
GAAACCAAGAACAAGTTCTCCCAGGCAAAGCTGTTGGCAGGAGCTGTGAAACATAAGAGCTCAGAGAGTG
GCAATAGTGTGAAGAGACTGAAACCAGACCCCGACCCAGATGACAAGGCTCAAGAGGCCCCGTCCTGCAT
GTCTCTTGGAAGCTCTTCTCTGAGCGGACCTCCCTCCATCCACTGCCCGTCGGCTGCTGTGTGCATCGGC
ATCCTCCCTGGCTTGGGCGCCTACTCTGGGAGCAGTGACTCCGAATCCAGTTCAGACAGTGAAGGCACCA
TCAATGCTACAGGGAAGATCGTCTCCTCCATCTTCCGAACCAACACCTTCCTCGAGGCACCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR203248 protein sequence
Red=Cloning site Green=Tags(s)

MDGEDDSNLVIKKRFVSEAELDERRKRRQEEWEKVRKPEDPKECPEEAYDPRSLYERLQEQKDRKQQEYE
EQFKFKNMVRGLDEDETNFLDEVSRQQDLIEKQRREEELEELKEYRSNLNKVGISAENKEVEKKLAVKPI
ETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPDPDDKAQEAPSCMSLGSSSLSGPPSIHCPSAAVCIG
ILPGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAP

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_028221
ORF Size 762 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_028221.1
RefSeq Size 1812 bp
RefSeq ORF 765 bp
Locus ID 102122
UniProt ID Q91WE2
Cytogenetics 8 C5
MW 28.7 kDa
Summary Promotes the association of the proteasome activator complex subunit PSME3 with the 20S proteasome and regulates its activity. Inhibits PSME3-mediated degradation of some proteasome substrates, probably by affecting their diffusion rate into the catalytic chamber of the proteasome. Also inhibits the interaction of PSME3 with COIL, inhibits accumulation of PSME3 in Cajal bodies and positively regulates the number of Cajal bodies in the nucleus.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Fam192a (NM_028221) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC201740 Fam192a (untagged) - Mouse family with sequence similarity 192, member A (Fam192a), (10ug) 10 ug
$300.00
MG203251 Fam192a (tGFP-tagged) - Mouse RIKEN cDNA 2310065K24 gene (2310065K24Rik) 10 ug
$500.00
MR203248L3 Lenti ORF clone of Fam192a (Myc-DDK-tagged) - Mouse family with sequence similarity 192, member A (Fam192a) 10 ug
$600.00
MR203248L4 Lenti ORF clone of Fam192a (mGFP-tagged) - Mouse family with sequence similarity 192, member A (Fam192a) 10 ug
$600.00
MR203251 Fam192a (Myc-DDK-tagged) - Mouse family with sequence similarity 192, member A (Fam192a) 10 ug
$289.00 MSRP $300.00 MSRP $300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.