Tfam (NM_009360) Mouse Tagged ORF Clone

SKU
MR203015
Tfam (Myc-DDK-tagged) - Mouse transcription factor A, mitochondrial (Tfam), nuclear gene encoding mitochondrial protein
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Tfam
Synonyms AI661103; Hmgts; mtTFA; tsHMG
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR203015 representing NM_009360
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCTGTTCCGGGGAATGTGGAGCGTGCTAAAAGCACTGGGGCGCACGGGGGTCGAGATGTGCGCGG
GCTGCGGGGGTCGCATCCCCTCGTCTATCAGTCTTGTCTGTATTCCGAAGTGTTTTTCCAGCATGGGTAG
CTATCCAAAGAAACCTATGAGTTCATACCTTCGATTTTCCACAGAACAGCTACCCAAATTTAAAGCTAAA
CACCCAGATGCAAAACTTTCAGAATTGGTTAGGAAAATTGCAGCCCTGTGGAGGGAGCTACCAGAAGCAG
AAAAAAAGGTTTATGAAGCTGATTTTAAAGCTGAGTGGAAAGCATACAAAGAAGCTGTGAGCAAGTATAA
AGAGCAGCTAACTCCAAGTCAGCTGATGGGTATGGAGAAGGAGGCCCGGCAGAGACGGTTAAAAAAGAAA
GCACTGGTAAAGAGAAGAGAATTAATTTTGCTTGGAAAACCAAAAAGACCTCGTTCAGCATATAACATTT
ATGTATCTGAAAGCTTCCAGGAGGCAAAGGATGATTCGGCTCAGGGAAAATTGAAGCTTGTAAATGAGGC
TTGGAAAAATCTGTCTCCTGAGGAAAAGCAGGCATATATTCAGCTTGCTAAAGATGATAGGATTCGTTAC
GACAATGAAATGAAGTCTTGGGAAGAGCAGATGGCTGAAGTTGGACGAAGTGATCTCATCCGTCGAAGTG
TGAAACGATCCGGAGACATCTCTGAGCAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR203015 representing NM_009360
Red=Cloning site Green=Tags(s)

MALFRGMWSVLKALGRTGVEMCAGCGGRIPSSISLVCIPKCFSSMGSYPKKPMSSYLRFSTEQLPKFKAK
HPDAKLSELVRKIAALWRELPEAEKKVYEADFKAEWKAYKEAVSKYKEQLTPSQLMGMEKEARQRRLKKK
ALVKRRELILLGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRY
DNEMKSWEEQMAEVGRSDLIRRSVKRSGDISEH

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_009360
ORF Size 729 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_009360.4
RefSeq Size 3920 bp
RefSeq ORF 732 bp
Locus ID 21780
UniProt ID P40630
Cytogenetics 10 36.83 cM
MW 28.4 kDa
Summary Isoform Mitochondrial binds to the mitochondrial light strand promoter and functions in mitochondrial transcription regulation. Required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. Promotes transcription initiation from the HSP1 and the light strand promoter by binding immediately upstream of transcriptional start sites. Is able to unwind DNA. Bends the mitochondrial light strand promoter DNA into a U-turn shape via its HMG boxes. Required for maintenance of normal levels of mitochondrial DNA. May play a role in organizing and compacting mitochondrial DNA. Isoform Nuclear may also function as a transcriptional activator or may have a structural role in the compaction of nuclear DNA during spermatogenesis.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Tfam (NM_009360) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC202747 Tfam (untagged) - Mouse transcription factor A, mitochondrial (Tfam), nuclear gene encoding mitochondrial protein, (10ug) 10 ug
$300.00
MG203015 Tfam (tGFP-tagged) - Mouse transcription factor A, mitochondrial (Tfam) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
MR203015L3 Lenti ORF clone of Tfam (Myc-DDK-tagged) - Mouse transcription factor A, mitochondrial (Tfam), nuclear gene encoding mitochondrial protein 10 ug
$600.00
MR203015L4 Lenti ORF clone of Tfam (mGFP-tagged) - Mouse transcription factor A, mitochondrial (Tfam), nuclear gene encoding mitochondrial protein 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.