Cdc34 (NM_177613) Mouse Tagged ORF Clone

SKU
MR202861
Cdc34 (Myc-DDK-tagged) - Mouse cell division cycle 34 homolog (S. cerevisiae) (Cdc34)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cdc34
Synonyms AI327276; E2-CDC34; UBE2R1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202861 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCGGCCGCTGGTGCCAAGCTCGCAGAAGGCGCTGCTGCTGGAACTGAAGGGGCTGCAGGAGGAGC
CGGTGGAGGGCTTCCGGGTGACGCTGGTGGACGAGGGTGACCTGTACAACTGGGAGGTGGCCATCTTCGG
GCCCCCCAACACCTACTATGAGGGCGGCTACTTCAAGGCTCGCCTCAAGTTCCCCATCGACTACCCGTAT
TCCCCACCAGCCTTCCGGTTCCTCACCAAGATGTGGCACCCAAACATCTATGAGACAGGGGACGTGTGCA
TCTCCATTCTCCATCCCCCAGTTGACGACCCACAGAGTGGGGAGCTGCCCTCAGAGCGGTGGAACCCCAC
ACAGAATGTCAGAACCATCCTCCTGAGTGTAATTTCGCTGCTGAATGAGCCCAACACCTTCTCGCCTGCC
AACGTGGACGCCTCGGTGATGTACAGAAAATGGAAGGAGAGCAAGGGGAAGGACCGCGAGTACACGGACA
TCATCCGGAAGCAGGTCCTGGGGACCAAGGTGGACGCGGAGCGCGATGGTGTGAAGGTGCCCACTACGCT
GGCCGAGTACTGCGTGAAGACCAAGGCGCCGGCGCCCGACGAGGGCTCGGACCTCTTCTACGACGACTAC
TATGAGGACGGCGAAGTGGAGGAGGCCGACAGCTGCTTTGGGGATGAAGAGGATGACTCTGGCACCGAAG
AGTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202861 protein sequence
Red=Cloning site Green=Tags(s)

MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPY
SPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPA
NVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDY
YEDGEVEEADSCFGDEEDDSGTEES

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_177613
ORF Size 705 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_177613.2, NP_808281.1
RefSeq Size 1295 bp
RefSeq ORF 708 bp
Locus ID 216150
UniProt ID Q8CFI2
Cytogenetics 10 39.72 cM
MW 26.6 kDa
Summary Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Cooperates with the E2 UBCH5C and the SCF(FBXW11) E3 ligase complex for the polyubiquitination of NFKBIA leading to its subsequent proteasomal degradation. Performs ubiquitin chain elongation building ubiquitin chains from the UBE2D3-primed NFKBIA-linked ubiquitin. UBE2D3 acts as an initiator E2, priming the phosphorylated NFKBIA target at positions 'Lys-21' and/or 'Lys-22' with a monoubiquitin. Cooperates with the SCF(SKP2) E3 ligase complex to regulate cell proliferation through ubiquitination and degradation of MYBL2 and KIP1. Involved in ubiquitin conjugation and degradation of CREM isoform ICERIIgamma and ATF15 resulting in abrogation of ICERIIgamma- and ATF5-mediated repression of cAMP-induced transcription during both meiotic and mitotic cell cycles. Involved in the regulation of the cell cycle G2/M phase through its targeting of the WEE1 kinase for ubiquitination and degradation. Also involved in the degradation of beta-catenin.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Cdc34 (NM_177613) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MR202861L3 Lenti ORF clone of Cdc34 (Myc-DDK-tagged) - Mouse cell division cycle 34 homolog (S. cerevisiae) (Cdc34) 10 ug
$600.00
MR202861L4 Lenti ORF clone of Cdc34 (mGFP-tagged) - Mouse cell division cycle 34 homolog (S. cerevisiae) (Cdc34) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.