Klrk1 (NM_033078) Mouse Tagged ORF Clone

SKU
MR202802
Klrk1 (Myc-DDK-tagged) - Mouse killer cell lectin-like receptor subfamily K, member 1 (Klrk1), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Klrk1
Synonyms D6H12S2489E; NKG2-D; Nkg2d
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202802 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCATTGATTCGTGATCGAAAGTCTCATCACTCAGAGATGAGCAAATGCCATAATTACGACCTCAAGC
CAGCAAAGTGGGATACTTCTCAAGAACAACAGAAACAAAGATTAGCACTAACTACCAGTCAACCTGGAGA
AAATGGTATCATAAGAGGAAGATACCCTATAGAAAAACTCAAAATATCTCCAATGTTCGTTGTTCGAGTC
CTTGCTATAGCCTTGGCAATTCGATTCACCCTTAACACATTGATGTGGCTTGCCATTTTCAAAGAGACGT
TTCAGCCAGTATTGTGCAACAAGGAAGTCCCAGTTTCCTCAAGAGAGGGCTACTGTGGCCCATGCCCTAA
CAACTGGATATGTCACAGAAACAACTGTTACCAATTTTTTAATGAAGAGAAAACCTGGAACCAGAGCCAA
GCTTCCTGTTTGTCTCAAAATTCCAGCCTTCTGAAGATATACAGTAAAGAAGAACAGGATTTCTTAAAGC
TGGTTAAGTCCTATCACTGGATGGGACTGGTCCAGATCCCAGCAAATGGCTCCTGGCAGTGGGAAGATGG
CTCCTCTCTCTCATACAATCAGTTAACTCTGGTGGAAATACCAAAAGGATCCTGTGCTGTCTATGGCTCA
AGCTTTAAGGCTTACACAGAAGACTGTGCAAATCTAAACACGTACATCTGCATGAAAAGGGCGGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202802 protein sequence
Red=Cloning site Green=Tags(s)

MALIRDRKSHHSEMSKCHNYDLKPAKWDTSQEQQKQRLALTTSQPGENGIIRGRYPIEKLKISPMFVVRV
LAIALAIRFTLNTLMWLAIFKETFQPVLCNKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQSQ
ASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGS
SFKAYTEDCANLNTYICMKRAV

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_033078
ORF Size 696 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_033078.4
RefSeq Size 3272 bp
RefSeq ORF 699 bp
Locus ID 27007
UniProt ID O54709
Cytogenetics 6 63.44 cM
MW 26.7 kDa
Summary Function as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. Acts as a costimulatory receptor for T-cell receptor (TCR) in CD8(+) T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. Participates in NK cell-mediated bone marrow graft rejection. May play a regulatory role in differentiation and survival of NK cells. Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins including RAET1A, RAET1B, RAET1C, RAET1D, RAET1E, H60 and MULT1.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Klrk1 (NM_033078) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC204602 Klrk1 (untagged) - Mouse killer cell lectin-like receptor subfamily K, member 1 (Klrk1), transcript variant 1, (10ug) 10 ug
$300.00
MG202802 Klrk1 (tGFP-tagged) - Mouse killer cell lectin-like receptor subfamily K, member 1 (Klrk1), transcript variant 1 10 ug
$500.00
MR202802L1 Lenti ORF clone of Klrk1 (Myc-DDK-tagged) - Mouse killer cell lectin-like receptor subfamily K, member 1 (Klrk1), transcript variant 1 10 ug
$600.00
MR202802L2 Lenti ORF clone of Klrk1 (mGFP-tagged) - Mouse killer cell lectin-like receptor subfamily K, member 1 (Klrk1), transcript variant 1 10 ug
$600.00
MR202802L3 Lenti ORF clone of Klrk1 (Myc-DDK-tagged) - Mouse killer cell lectin-like receptor subfamily K, member 1 (Klrk1), transcript variant 1 10 ug
$600.00
MR202802L4 Lenti ORF clone of Klrk1 (mGFP-tagged) - Mouse killer cell lectin-like receptor subfamily K, member 1 (Klrk1), transcript variant 1 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.