Cd79b (NM_008339) Mouse Tagged ORF Clone

SKU
MR202725
Cd79b (Myc-DDK-tagged) - Mouse CD79B antigen (Cd79b)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cd79b
Synonyms B29; Ig; Ig-be; Ig-beta; Igb; Igbe; Igbeta
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202725 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACACTGGTGCTGTCTTCCATGCCCTGCCACTGGCTGTTGTTCCTGCTGCTGCTCTTCTCAGGTG
AGCCGGTACCAGCAATGACAAGCAGTGACCTGCCACTGAATTTCCAAGGAAGCCCTTGTTCCCAGATCTG
GCAGCACCCGAGGTTTGCAGCCAAAAAGCGGAGCTCCATGGTGAAGTTTCACTGCTACACAAACCACTCA
GGTGCACTGACCTGGTTCCGAAAGCGAGGGAGCCAGCAGCCCCAGGAACTGGTCTCAGAAGAGGGACGCA
TTGTGCAGACCCAGAATGGCTCTGTCTACACCCTCACTATCCAAAACATCCAGTACGAGGATAATGGTAT
CTACTTCTGCAAGCAGAAATGTGACAGCGCCAACCATAATGTCACCGACAGCTGTGGCACGGAACTTCTA
GTCTTAGGATTCAGCACGTTGGACCAACTGAAGCGGCGGAACACACTGAAAGATGGCATTATCTTGATCC
AGACCCTCCTCATCATCCTCTTCATCATTGTGCCCATCTTCCTGCTACTTGACAAGGATGACGGCAAGGC
TGGGATGGAGGAAGATCACACCTATGAGGGCTTGAACATTGACCAGACAGCCACCTATGAAGACATAGTG
ACTCTTCGGACAGGGGAGGTAAAGTGGTCGGTAGGAGAGCATCCAGGCCAGGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202725 protein sequence
Red=Cloning site Green=Tags(s)

MATLVLSSMPCHWLLFLLLLFSGEPVPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHS
GALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELL
VLGFSTLDQLKRRNTLKDGIILIQTLLIILFIIVPIFLLLDKDDGKAGMEEDHTYEGLNIDQTATYEDIV
TLRTGEVKWSVGEHPGQE

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_008339
ORF Size 684 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_008339.3
RefSeq Size 1232 bp
RefSeq ORF 687 bp
Locus ID 15985
UniProt ID P15530
Cytogenetics 11 68.89 cM
MW 25.7 kDa
Summary The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Sep 2015]
Write Your Own Review
You're reviewing:Cd79b (NM_008339) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC201002 Cd79b (untagged) - Mouse CD79B antigen (Cd79b), (10ug) 10 ug
$300.00
MG202725 Cd79b (tGFP-tagged) - Mouse CD79B antigen (Cd79b) 10 ug
$500.00
MR202725L3 Lenti ORF clone of Cd79b (Myc-DDK-tagged) - Mouse CD79B antigen (Cd79b) 10 ug
$600.00
MR202725L4 Lenti ORF clone of Cd79b (mGFP-tagged) - Mouse CD79B antigen (Cd79b) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.