Nat8 (NM_023455) Mouse Tagged ORF Clone

SKU
MR202704
Nat8 (Myc-DDK-tagged) - Mouse N-acetyltransferase 8 (GCN5-related, putative) (Nat8)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Nat8
Synonyms 0610037O16Rik; CCNAT; Cml4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202704 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTCTTTTCGCATCCGCCAGTTCCAGGAGAGGGACTACAAACAGGTCGTGGATGTGTTCTCCAGGG
GCATGGAGGAGCACATACCCACTGCCTTCCGCCACTTGCTGACACTGCCCCGAACCCTCCTGCTCTTAGC
TGTGGTGCCCCTTGCCATAGTCCTGGTGTCTGGCTCCTGGTTCCTGGCTGTTGTATGCATTTTCTTTCTG
TTCCTATTCTTGTGGTTCCTCGCCAGCAAGCCCTGGAAGAATTATGTGTCCAAATGTTTACACACAGACA
TGGCTGACATCACCAAGTCCTACCTGAGTGTCCGTGGCTCAGGTTTCTGGGTGGCTGAGTCTGGGGGGCA
GGTGGTGGGTACAGTGGCTGCTCGGCCAGTCAAGGATCCTCCGTTAGGGAGGAAGCAGCTGCAGCTCTTT
CGCCTGTCTGTGTCCTCACAGCATCGAGGACAGGGGATAGCGAAAGCGCTGACCAGAACTGTCCTCCAGT
TTGCAAGGGACCAGGGTTACAGTGATGTTGTCCTTGTGACTGGCCTTTTGCAGCAAGGTGCTGTGACTCT
CTACTACAGCATGGGCTTCCAGAAGACAGGTGAATCCTTCGTGGACATACTCACATGGCTTGTGGATGTT
TCTCTAATTCATTTCATATACCCACTCCCTTCTGCTCAAAAATATGAGTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202704 protein sequence
Red=Cloning site Green=Tags(s)

MASFRIRQFQERDYKQVVDVFSRGMEEHIPTAFRHLLTLPRTLLLLAVVPLAIVLVSGSWFLAVVCIFFL
FLFLWFLASKPWKNYVSKCLHTDMADITKSYLSVRGSGFWVAESGGQVVGTVAARPVKDPPLGRKQLQLF
RLSVSSQHRGQGIAKALTRTVLQFARDQGYSDVVLVTGLLQQGAVTLYYSMGFQKTGESFVDILTWLVDV
SLIHFIYPLPSAQKYEL

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_023455
ORF Size 681 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_023455.4
RefSeq Size 941 bp
RefSeq ORF 684 bp
Locus ID 68396
UniProt ID Q9JIY7
Cytogenetics 6 C3
MW 25.6 kDa
Summary Acetylates the free alpha-amino group of cysteine S-conjugates to form mercapturic acids. This is the final step in a major route for detoxification of a wide variety of reactive electrophiles which starts with their incorporation into glutathione S-conjugates. The glutathione S-conjugates are then further processed into cysteine S-conjugates and finally mercapturic acids which are water soluble and can be readily excreted in urine or bile. Alternatively, may have a lysine N-acetyltransferase activity catalyzing peptidyl-lysine N6-acetylation of various proteins. Thereby, may regulate apoptosis through the acetylation and the regulation of the expression of PROM1. May also regulate amyloid beta-peptide secretion through acetylation of BACE1 and the regulation of its expression in neurons (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Nat8 (NM_023455) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MG202704 Nat8 (tGFP-tagged) - Mouse camello-like 4 (Cml4) 10 ug
$500.00
MR202704L3 Lenti ORF clone of Nat8 (Myc-DDK-tagged) - Mouse N-acetyltransferase 8 (GCN5-related, putative) (Nat8) 10 ug
$600.00
MR202704L4 Lenti ORF clone of Nat8 (mGFP-tagged) - Mouse N-acetyltransferase 8 (GCN5-related, putative) (Nat8) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.