Laptm4b (NM_033521) Mouse Tagged ORF Clone

SKU
MR202675
Laptm4b (Myc-DDK-tagged) - Mouse lysosomal-associated protein transmembrane 4B (Laptm4b)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Laptm4b
Synonyms C330023P13Rik; LAPTM4beta
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202675 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGATGGTCGCTCCCTGGACTCGGTTCTACTCCCACAGCTGCTGTTTGTGCTGCCATGTCCGCACCG
GCACCATCCTGCTGGGCGTCTGGTACCTGATCATCAATGCTGTGGTCCTGCTGATCCTGCTGAGTGCCCT
GGCAGATCCCAATCAGTATCACTTTTCAGGCTCTGAACTAGGAGGGGAGTTTGAGTTCATGGATGATGCC
AACATGTGCATTGCTATCGCAATCTCTCTCCTCATGATCCTGATATGTGCCATGGCTACTTACGGTGCAT
ACAAGCAACATGCTGCCTGGATCATCCCGTTCTTCTGTTACCAGATCTTTGATTTTGCCCTGAATACTTT
GGTTGCAATCACTGTGCTTGTCTATCCGAACTCCATTCAGGAATACATACGACAGCTGCCTCCTAGCTTT
CCCTACAGAGATGATATAATGTCCGTGAATCCTACCTGTTTGGTCCTTATTATTCTTCTGTTTATCGGCA
TTCTTTTGACACTTAAGGGCTACTTGATTAGCTGCGTTTGGAGCTGCTACAGGTACATCAACGGCAGGAA
CTCCTCCGATGTCCTGGTGTATGTTACCAGCAATGATACCACAGTGCTGCTGCCTCCGTACGATGATGCT
ACTGCTGTGCCTAGCACTGCCAAGGAACCACCACCACCTTACGTGTCCGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202675 protein sequence
Red=Cloning site Green=Tags(s)

MKMVAPWTRFYSHSCCLCCHVRTGTILLGVWYLIINAVVLLILLSALADPNQYHFSGSELGGEFEFMDDA
NMCIAIAISLLMILICAMATYGAYKQHAAWIIPFFCYQIFDFALNTLVAITVLVYPNSIQEYIRQLPPSF
PYRDDIMSVNPTCLVLIILLFIGILLTLKGYLISCVWSCYRYINGRNSSDVLVYVTSNDTTVLLPPYDDA
TAVPSTAKEPPPPYVSA

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_033521
ORF Size 681 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_033521.3, NP_277056.1
RefSeq Size 1897 bp
RefSeq ORF 684 bp
Locus ID 114128
UniProt ID Q91XQ6
Cytogenetics 15 B3.1
MW 25.4 kDa
Summary Required for optimal lysosomal function. Blocks EGF-stimulated EGFR intraluminal sorting and degradation. Conversely by binding with the phosphatidylinositol 4,5-bisphosphate, regulates its PIP5K1C interaction, inhibits HGS ubiquitination and relieves LAPTM4B inhibition of EGFR degradation. Recruits SLC3A2 and SLC7A5 (the Leu transporter) to the lysosome, promoting entry of leucine and other essential amino acid (EAA) into the lysosome, stimulating activation of proton-transporting vacuolar (V)-ATPase protein pump (V-ATPase) and hence mTORC1 activation. Plays a role as negative regulator of TGFB1 production in regulatory T cells. Binds ceramide and facilitates its exit from late endosome in order to control cell death pathways.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Laptm4b (NM_033521) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC201564 Laptm4b (untagged) - Mouse lysosomal-associated protein transmembrane 4B (Laptm4b), (10ug) 10 ug
$300.00
MG202675 Laptm4b (tGFP-tagged) - Mouse lysosomal-associated protein transmembrane 4B (Laptm4b) 10 ug
$500.00
MR202675L3 Lenti ORF clone of Laptm4b (Myc-DDK-tagged) - Mouse lysosomal-associated protein transmembrane 4B (Laptm4b) 10 ug
$600.00
MR202675L4 Lenti ORF clone of Laptm4b (mGFP-tagged) - Mouse lysosomal-associated protein transmembrane 4B (Laptm4b) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.