Prl2c4 (NM_011954) Mouse Tagged ORF Clone

SKU
MR202595
Prl2c4 (Myc-DDK-tagged) - Mouse prolactin family 2, subfamily c, member 4 (Prl2c4)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Prl2c4
Synonyms MRP-3; mrp/plf3; Mrpplf3; PLF-3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202595 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCCCTTCTTTGATTCAACCATGCTCCTGGATACTGCTCCTACTACTGGTGAACAGCTCGTTATTGT
GGAAGAATGTTGCCTCATTTCCCATGTGTGCAATGAGGAATGGTCGTTGCTTTATGTCCTTTGAAGACAC
ATTTGAATTAGCCGGCAGTTTGTCTCATAATATCAGTATAGAAGTTTCAGAACTGTTCACTGAATTTGAA
AAACATTATTCTAACGTGTCTGGGCTCAGAGACAAAAGCCCCATGGGATGCAATACTTCTTTCCTTCCAA
CTCCAGAAAGCAAGGAACAAGCCAGGCTCACACACTATTCAGCTCTTCTGAAATCAGGAGCCATGATTTT
GGATGCCTGGGAAAGCCCTCTGGACGATCTAGTGAGTGAATTGTCTACCATAAAAAATGTCCCTGATATA
ATCATCTCCAAAGCCACAGACATAAAGAAAAAGATCAACGCAGTCCGGAACGGGGTTAATGCCCTCATGA
GCACCATGCTTCAGAATGGAGATGAAGAAAAGAAGAACCCTGCCTGGTTCTTGCAATCTGACAATGAAGA
TGCTCGCATTCATTCTTTATATGGCATGATCAGCTGCCTAGACAATGACTTTAAGAAGGTTGATATTTAT
CTCAACGTCCTGAAGTGTTACATGTTAAAAATAGATAACTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202595 protein sequence
Red=Cloning site Green=Tags(s)

MLPSLIQPCSWILLLLLVNSSLLWKNVASFPMCAMRNGRCFMSFEDTFELAGSLSHNISIEVSELFTEFE
KHYSNVSGLRDKSPMGCNTSFLPTPESKEQARLTHYSALLKSGAMILDAWESPLDDLVSELSTIKNVPDI
IISKATDIKKKINAVRNGVNALMSTMLQNGDEEKKNPAWFLQSDNEDARIHSLYGMISCLDNDFKKVDIY
LNVLKCYMLKIDNC

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_011954
ORF Size 672 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_011954.1, NM_011954.2, NP_036084.2
RefSeq Size 869 bp
RefSeq ORF 675 bp
Locus ID 26421
UniProt ID P04768
Cytogenetics 13 A1
MW 25.2 kDa
Summary May have a role in embryonic development. It is likely to provide a growth stimulus to target cells in maternal and fetal tissues during the development of the embryo at mid-gestation. May play a role during wound healing and in the hair follicle cycle as a growth factor and/or an angiogenesis factor. May play a role in microvilli formation and cell proliferation of neuroblastoma cells.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Prl2c4 (NM_011954) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC207460 Prl2c4 (untagged) - Mouse prolactin family 2, subfamily c, member 4 (Prl2c4), (10ug) 10 ug
$330.00
MG202595 Prl2c4 (tGFP-tagged) - Mouse mitogen regulated protein, proliferin 3 (Mrpplf3) 10 ug
$500.00
MR202595L3 Lenti ORF clone of Prl2c4 (Myc-DDK-tagged) - Mouse prolactin family 2, subfamily c, member 4 (Prl2c4) 10 ug
$600.00
MR202595L4 Lenti ORF clone of Prl2c4 (mGFP-tagged) - Mouse prolactin family 2, subfamily c, member 4 (Prl2c4) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.