Fam60a (NM_019643) Mouse Tagged ORF Clone

SKU
MR202537
Fam60a (Myc-DDK-tagged) - Mouse family with sequence similarity 60, member A (Fam60a)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Fam60a
Synonyms Ppcs1; Pptcs1; Tera
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202537 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTGGTTTTCACAAGCCAAAGATGTACCGAAGTATAGAGGGCTGCTGTATATGCAGAGCCAAGTCCT
CCAGCTCCCGGTTCACGGACAGTAAACGTTACGAAAAGGACTTCCAGAGCTGTTTTGGGTTGCATGAGAC
TCGCTCAGGAGACATCTGTAATGCCTGTGTGCTGCTTGTGAAAAGATGGAAGAAGTTGCCGGCAGGATCA
AAAAAAAACTGGAATCACGTGGTAGATGCAAGAGCAGGCCCTAGTCTAAAGACAACATTGAAACCAAAGA
AAGTGAAAACTCTATCTGGAAACAGGATGAAAAGCAACCAGATCAGCAAACTGCAGAAGGAATTTAAACG
CCACAACTCTGATGCTCACAGTACCACCTCAAGTGCCTCTCCAGCCCAGTCTCCATGCTACAGTAACCAG
TCAGATGAGGGCTCAGATACAGAGATGGCTTCCAGCTCTAATAGAACTCCGGTTTTTTCCTTCTTAGATC
TTACCTACTGGAAAAGACAGAAAATATGTTGTGGGATCATCTATAAAGGCCGTTTTGGGGAAGTCCTCAT
CGACACTCATCTCTTCAAGCCTTGCTGCAGCAGTAAGAAAGCAGCTGCCGAGAAGCCCGAGGAGCAGGGG
CCGGCACCTCTGCCCATCTCCACTCAGGAGTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202537 protein sequence
Red=Cloning site Green=Tags(s)

MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGS
KKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRMKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQ
SDEGSDTEMASSSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSSKKAAAEKPEEQG
PAPLPISTQEW

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_019643
ORF Size 663 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_019643.4
RefSeq Size 2640 bp
RefSeq ORF 666 bp
Locus ID 56306
UniProt ID Q8C8M1
Cytogenetics 6 G3
MW 24.8 kDa
Summary Subunit of the Sin3 deacetylase complex (Sin3/HDAC), this subunit is important for the repression of genes encoding components of the TGF-beta signaling pathway (By similarity). Core component of a SIN3A complex (composed of at least SINHCAF, SIN3A, HDAC1, SAP30, RBBP4, OGT and TET1) present in embryonic stem (ES) cells. Promotes the stability of SIN3A and its presence on chromatin and is essential for maintaining the potential of ES cells to proliferate rapidly, while ensuring a short G1-phase of the cell cycle, thereby preventing premature lineage priming (PubMed:28554894).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Fam60a (NM_019643) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC203541 Fam60a (untagged) - Mouse family with sequence similarity 60, member A (Fam60a), (10ug) 10 ug
$300.00
MG202537 Fam60a (tGFP-tagged) - Mouse teratocarcinoma expressed, serine rich (Tera) 10 ug
$500.00
MR202537L3 Lenti ORF clone of Fam60a (Myc-DDK-tagged) - Mouse family with sequence similarity 60, member A (Fam60a) 10 ug
$600.00
MR202537L4 Lenti ORF clone of Fam60a (mGFP-tagged) - Mouse family with sequence similarity 60, member A (Fam60a) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.