Gpx6 (NM_145451) Mouse Tagged ORF Clone

SKU
MR202525
Txnrd2 (Myc-DDK-tagged) - Mouse thioredoxin reductase 2 (cDNA clone MGC:5671 IMAGE:3584154), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$226.00
In Stock*
Specifications
Product Data
Type Mouse Untagged ORF Clone
Target Symbol Gpx6
Synonyms 1700020G18Rik; olfa; olfactory; Ry2d1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202525 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCAGAAGTTGTGGGGTTCCTGTCTTTTCTCATTGTTTATGGCTGCCTTAGCTCAGGAGACTCTGA
ATCCTCAAAAATCGAAGGTGGATTGCAACAAAGGGGTGACTGGCACCGTCTATGAGTATGGAGCCAACAC
CATAGATGGTGGGGGGTTTGTCAACTTCCAGCAGTATGCAGGAAAGCACATCCTCTTTGTCAACGTGGCA
TCCTTCTGTGGCCTGACAGCTACGTACCCTGAGTTGAACACACTGCAGGAGGAGCTGAAGCCATTCAACG
TCACGGTTTTGGGCTTTCCGTGCAACCAGTTCGGAAAGCAAGAACCTGGAAAGAACTCAGAGATTCTCCT
TGGACTCAAGTATGTGCGTCCAGGCGGTGGCTATGTCCCCAATTTCCAGCTCTTTGAGAAGGGGGATGTG
AACGGAGACAATGAACAAAAGGTTTTTTCTTTCCTAAAGAACTCCTGCCCTCCCACCTCTGAACTTTTTG
GCTCTCCAGAACATCTCTTCTGGGATCCCATGAAGATTCATGATATCCGCTGGAACTTTGAGAAGTTCCT
GGTGGGACCTGATGGAGTCCCTGTCATGCGCTGGTTCCACCATACTCCTGTCAGAATTGTCCAGTCAGAC
ATCATGGAGTACCTAAACCAAACCAGTACCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202525 protein sequence
Red=Cloning site Green=Tags(s)

MAQKLWGSCLFSLFMAALAQETLNPQKSKVDCNKGVTGTVYEYGANTIDGGGFVNFQQYAGKHILFVNVA
SFCGLTATYPELNTLQEELKPFNVTVLGFPCNQFGKQEPGKNSEILLGLKYVRPGGGYVPNFQLFEKGDV
NGDNEQKVFSFLKNSCPPTSELFGSPEHLFWDPMKIHDIRWNFEKFLVGPDGVPVMRWFHHTPVRIVQSD
IMEYLNQTSTQ

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_145451
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins.
OTI Annotation This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_145451.2
RefSeq Size 1262 bp
RefSeq ORF 666 bp
Locus ID 75512
UniProt ID Q91WR8
Cytogenetics 13 A3.1
Summary This gene encodes a member of the glutathione peroxidase family. Glutathione peroxidases catalyze the reduction of a variety of hydroperoxides using glutathione as a specific electron donor substrate, and thereby protect cells against oxidative damage. Expression of this gene is restricted to embryos and adult olfactory epithelium. The mouse and rat orthologs contain a cysteine (Cys) residue at the active site, unlike the human counterpart, which is a selenoprotein, containing selenocysteine (Sec) instead. [provided by RefSeq, Jul 2017]
Write Your Own Review
You're reviewing:Gpx6 (NM_145451) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MG202525 Gpx6 (GFP-tagged) - Mouse glutathione peroxidase 6 (Gpx6), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) 10 ug
$426.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.