Nol3 (NM_030152) Mouse Tagged ORF Clone

SKU
MR202500
Nol3 (Myc-DDK-tagged) - Mouse nucleolar protein 3 (apoptosis repressor with CARD domain) (Nol3)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Nol3
Synonyms ARC; B430311C09Rik; MYC; NOP; Nop30
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202500 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCAACGTGCAGGAGCGCCCATCAGAGACCATTGACCGGGAACGGAAACGGCTGGTAGAGACATTGC
AGGCTGACTCTGGGCTGCTGCTGGATGCGCTGGTGGCCCGGGGCGTCCTCACTGGGCCCGAGTACGAAGC
CTTGGATGCGCTGCCCGATGCAGAGCGCAGGGTGCGCCGCCTACTGCTGTTGGTGCAGAGCAAGGGCGAG
GCAGCCTGCCAGGAGCTACTGCGCTGTGCCCAGCAAACAGTGCGCATGCCAGACCCGGCCTGGGATTGGC
AGCACGTGGGGCCCGGCTACCGGAACCGCAGCTATGACCCTTCATGCCCAGGCCACTGGACGCCAGAAGC
ACCCAGTTCAGGGACCACATGTCCTGAGCTGCCAAGAGCGTCAGAGCAAGAGGAGGTCGGAGGTCCTGAG
GGCTCTGAGGCACTGCAGCCTCGAACTCCAGAGGAGCCAGAACTAGAAGCTGAAGCTACTGAAGGGGATG
AGCCAGACCTGGAACAAGAAATGAATCCAGAACAAGAGCCGGAGCCGGAGCCCGAGCCAGAACCCGAACC
CGAGCCCGAGCCGGAACCCGAGCCCGAGCCAGAACCCGAGCCCGAGCCGGAACCCGAACCCGAGCCCGAC
TTCCAAGAAGAGGATGAATTTGAAGATTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202500 protein sequence
Red=Cloning site Green=Tags(s)

MGNVQERPSETIDRERKRLVETLQADSGLLLDALVARGVLTGPEYEALDALPDAERRVRRLLLLVQSKGE
AACQELLRCAQQTVRMPDPAWDWQHVGPGYRNRSYDPSCPGHWTPEAPSSGTTCPELPRASEQEEVGGPE
GSEALQPRTPEEPELEAEATEGDEPDLEQEMNPEQEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPD
FQEEDEFEDS

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_030152
ORF Size 660 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_030152.1, NM_030152.2, NM_030152.3, NM_030152.4, NP_084428.1
RefSeq Size 2869 bp
RefSeq ORF 663 bp
Locus ID 78688
UniProt ID Q9D1X0
Cytogenetics 8 53.04 cM
MW 24.6 kDa
Summary Apoptosis repressor that blocks multiple modes of cell death. Inhibits extrinsic apoptotic pathways through two different ways. Firstly by interacting with FAS and FADD upon FAS activation blocking death-inducing signaling complex (DISC) assembly (By similarity). Secondly by interacting with CASP8 in a mitochondria localization- and phosphorylation-dependent manner, limiting the amount of soluble CASP8 available for DISC-mediated activation (By similarity). Inhibits intrinsic apoptotic pathway in response to a wide range of stresses, through its interaction with BAX resulting in BAX inactivation, preventing mitochondrial dysfunction and release of pro-apoptotic factors (PubMed:16505176) (PubMed:24312627). Inhibits calcium-mediated cell death by functioning as a cytosolic calcium buffer, dissociating its interaction with CASP8 and maintaining calcium homeostasis (By similarity). Negatively regulates oxidative stress-induced apoptosis by phosphorylation-dependent suppression of the mitochondria-mediated intrinsic pathway, by blocking CASP2 activation and BAX translocation (By similarity). Negatively regulates hypoxia-induced apoptosis in part by inhibiting the release of cytochrome c from mitochondria in a caspase-independent manner (By similarity). Also inhibits TNF-induced necrosis by preventing TNF-signaling pathway through TNFRSF1A interaction abrogating the recruitment of RIPK1 to complex I (PubMed:24440909). Finally through its role as apoptosis repressor, promotes vascular remodeling through inhibition of apoptosis and stimulation of proliferation, in response to hypoxia (PubMed:22082675). Inhibits too myoblast differentiation through caspase inhibition (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Nol3 (NM_030152) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC201500 Nol3 (untagged) - Mouse nucleolar protein 3 (apoptosis repressor with CARD domain) (Nol3), (10ug) 10 ug
$300.00
MG202500 Nol3 (tGFP-tagged) - Mouse nucleolar protein 3 (apoptosis repressor with CARD domain) (Nol3) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
MR202500L3 Lenti ORF clone of Nol3 (Myc-DDK-tagged) - Mouse nucleolar protein 3 (apoptosis repressor with CARD domain) (Nol3) 10 ug
$600.00
MR202500L4 Lenti ORF clone of Nol3 (mGFP-tagged) - Mouse nucleolar protein 3 (apoptosis repressor with CARD domain) (Nol3) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.