Cldn6 (NM_018777) Mouse Tagged ORF Clone

SKU
MR202486
Cldn6 (Myc-DDK-tagged) - Mouse claudin 6 (Cldn6)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cldn6
Synonyms AL024037
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202486 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCTACTGGTCTGCAAATCTTGGGGATCGTCCTGACCCTGCTTGGCTGGGTCAACGCCCTGGTGT
CCTGTGCCCTGCCCATGTGGAAGGTGACCGCCTTCATCGGCAACAGCATCGTCGTGGCCCAGATGGTGTG
GGAGGGGCTGTGGATGTCCTGTGTGGTTCAGAGCACTGGCCAGATGCAGTGCAAGGTGTATGACTCACTG
TTGGCGCTGCCCCAGGACCTGCAGGCTGCCAGAGCCCTCTGTGTTGTCACCCTCCTCATTGTCCTGCTTG
GCCTGCTCGTGTACCTGGCTGGAGCCAAGTGCACTACCTGTGTGGAAGATAGGAACTCCAAGTCTCGTCT
GGTGCTCATCTCTGGCATCATCTTTGTCATTTCTGGGGTCCTGACGCTCATTCCTGTCTGCTGGACTGCC
CACTCTATCATCCAGGACTTCTACAACCCCTTGGTGGCTGATGCTCAAAAGCGGGAGCTGGGGGCCTCCC
TCTACCTGGGCTGGGCAGCCTCAGGCCTTTTGCTGCTGGGTGGAGGGCTACTATGCTGCGCCTGCTCTTC
TGGAGGGACCCAGGGACCCAGACATTACATGGCCTGCTATTCTACATCTGTCCCACATTCTCGGGGACCC
TCCGAATATCCCACCAAGAATTATGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202486 protein sequence
Red=Cloning site Green=Tags(s)

MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTGQMQCKVYDSL
LALPQDLQAARALCVVTLLIVLLGLLVYLAGAKCTTCVEDRNSKSRLVLISGIIFVISGVLTLIPVCWTA
HSIIQDFYNPLVADAQKRELGASLYLGWAASGLLLLGGGLLCCACSSGGTQGPRHYMACYSTSVPHSRGP
SEYPTKNYV

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018777
ORF Size 657 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018777.4
RefSeq Size 1522 bp
RefSeq ORF 660 bp
Locus ID 54419
UniProt ID Q9Z262
Cytogenetics 17 A3.3
MW 23.4 kDa
Summary This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The protein encoded by this gene is essential for blastocyst formation in preimplantation mouse embryos, and is invloved in and is crucial for the formation and maintenance of the epidermal permeability barrier. This gene is adjacent to another family member Cldn9 on chromosome 17. [provided by RefSeq, Aug 2010]
Write Your Own Review
You're reviewing:Cldn6 (NM_018777) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC201867 Cldn6 (untagged) - Mouse claudin 6 (Cldn6), (10ug) 10 ug
$300.00
MG202486 Cldn6 (tGFP-tagged) - Mouse claudin 6 (Cldn6) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
MR202486L3 Lenti ORF clone of Cldn6 (Myc-DDK-tagged) - Mouse claudin 6 (Cldn6) 10 ug
$600.00
MR202486L4 Lenti ORF clone of Cldn6 (mGFP-tagged) - Mouse claudin 6 (Cldn6) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.